BLASTX nr result
ID: Glycyrrhiza23_contig00011896
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00011896 (739 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515578.1| Nudix hydrolase 20, chloroplast precursor, p... 60 5e-07 ref|XP_003551432.1| PREDICTED: nudix hydrolase 20, chloroplastic... 56 7e-06 >ref|XP_002515578.1| Nudix hydrolase 20, chloroplast precursor, putative [Ricinus communis] gi|223545522|gb|EEF47027.1| Nudix hydrolase 20, chloroplast precursor, putative [Ricinus communis] Length = 329 Score = 60.1 bits (144), Expect = 5e-07 Identities = 32/48 (66%), Positives = 34/48 (70%), Gaps = 2/48 (4%) Frame = -3 Query: 392 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF--EAYANLENLICMR 255 AIPV AVSYMDIE YRYK DVLFCYDL LP F + NLE L+ R Sbjct: 271 AIPVGAVSYMDIEEYRYKRDVLFCYDLKLPDGFIPKNQGNLEALLAFR 318 >ref|XP_003551432.1| PREDICTED: nudix hydrolase 20, chloroplastic-like [Glycine max] Length = 361 Score = 56.2 bits (134), Expect = 7e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -3 Query: 392 AIPVSAVSYMDIEGYRYKGDVLFCYDLILPISF 294 AIPV AVSY DI+GYRYK DVLFCYDL LP F Sbjct: 261 AIPVGAVSYKDIDGYRYKRDVLFCYDLKLPKDF 293