BLASTX nr result
ID: Glycyrrhiza23_contig00011757
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00011757 (252 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003625401.1| Pleiotropic drug resistance protein [Medicag... 155 3e-36 ref|XP_003625400.1| Pleiotropic drug resistance protein [Medicag... 153 1e-35 ref|XP_003625399.1| Pleiotropic drug resistance protein [Medicag... 153 1e-35 ref|XP_003625398.1| Pleiotropic drug resistance protein [Medicag... 149 2e-34 ref|XP_003625363.1| Pleiotropic drug resistance ABC transporter ... 149 2e-34 >ref|XP_003625401.1| Pleiotropic drug resistance protein [Medicago truncatula] gi|355500416|gb|AES81619.1| Pleiotropic drug resistance protein [Medicago truncatula] Length = 1483 Score = 155 bits (392), Expect = 3e-36 Identities = 77/84 (91%), Positives = 81/84 (96%) Frame = +1 Query: 1 TIEVRFEHLNIEAEAHVGGRALPTFTNFMVNIVEGLLNSLHILPSRSQHINILRDVSGII 180 TIEVRFEHLNIEAEA VG R+LPTFTNFMVNIVEGLLNSLH+LPSR QH+NILRDVSGI+ Sbjct: 111 TIEVRFEHLNIEAEARVGSRSLPTFTNFMVNIVEGLLNSLHVLPSRKQHLNILRDVSGIL 170 Query: 181 KPSRMTLLLGPPSSGKTTLLLALA 252 KPSRMTLLLGPPSSGKTTLLLALA Sbjct: 171 KPSRMTLLLGPPSSGKTTLLLALA 194 >ref|XP_003625400.1| Pleiotropic drug resistance protein [Medicago truncatula] gi|355500415|gb|AES81618.1| Pleiotropic drug resistance protein [Medicago truncatula] Length = 1398 Score = 153 bits (387), Expect = 1e-35 Identities = 76/84 (90%), Positives = 81/84 (96%) Frame = +1 Query: 1 TIEVRFEHLNIEAEAHVGGRALPTFTNFMVNIVEGLLNSLHILPSRSQHINILRDVSGII 180 TIEVRFE LNIEAEAHVG R+LPTFTNFMVNIVEGLLNSLH+LPSR QH+NIL+DVSGI+ Sbjct: 111 TIEVRFEGLNIEAEAHVGNRSLPTFTNFMVNIVEGLLNSLHVLPSRKQHLNILKDVSGIL 170 Query: 181 KPSRMTLLLGPPSSGKTTLLLALA 252 KPSRMTLLLGPPSSGKTTLLLALA Sbjct: 171 KPSRMTLLLGPPSSGKTTLLLALA 194 >ref|XP_003625399.1| Pleiotropic drug resistance protein [Medicago truncatula] gi|355500414|gb|AES81617.1| Pleiotropic drug resistance protein [Medicago truncatula] Length = 1469 Score = 153 bits (387), Expect = 1e-35 Identities = 76/84 (90%), Positives = 81/84 (96%) Frame = +1 Query: 1 TIEVRFEHLNIEAEAHVGGRALPTFTNFMVNIVEGLLNSLHILPSRSQHINILRDVSGII 180 TIEVRFE LNIEAEAHVG R+LPTFTNFMVNIVEGLLNSLH+LPSR QH+NIL+DVSGI+ Sbjct: 111 TIEVRFEGLNIEAEAHVGNRSLPTFTNFMVNIVEGLLNSLHVLPSRKQHLNILKDVSGIL 170 Query: 181 KPSRMTLLLGPPSSGKTTLLLALA 252 KPSRMTLLLGPPSSGKTTLLLALA Sbjct: 171 KPSRMTLLLGPPSSGKTTLLLALA 194 >ref|XP_003625398.1| Pleiotropic drug resistance protein [Medicago truncatula] gi|355500413|gb|AES81616.1| Pleiotropic drug resistance protein [Medicago truncatula] Length = 1444 Score = 149 bits (377), Expect = 2e-34 Identities = 74/84 (88%), Positives = 81/84 (96%) Frame = +1 Query: 1 TIEVRFEHLNIEAEAHVGGRALPTFTNFMVNIVEGLLNSLHILPSRSQHINILRDVSGII 180 TIEVRFEHLNIEAEA+VG R+LPTFTNFMVNIV GLLNSLH+LPSR QH+NILR+VSGII Sbjct: 111 TIEVRFEHLNIEAEANVGSRSLPTFTNFMVNIVLGLLNSLHVLPSRKQHLNILREVSGII 170 Query: 181 KPSRMTLLLGPPSSGKTTLLLALA 252 KPSR+TLLLGPPSSGKTT+LLALA Sbjct: 171 KPSRITLLLGPPSSGKTTILLALA 194 >ref|XP_003625363.1| Pleiotropic drug resistance ABC transporter family protein [Medicago truncatula] gi|355500378|gb|AES81581.1| Pleiotropic drug resistance ABC transporter family protein [Medicago truncatula] Length = 891 Score = 149 bits (377), Expect = 2e-34 Identities = 75/84 (89%), Positives = 79/84 (94%) Frame = +1 Query: 1 TIEVRFEHLNIEAEAHVGGRALPTFTNFMVNIVEGLLNSLHILPSRSQHINILRDVSGII 180 TIEVRFEHLNIEAEAHVG +LPTFTNFMVNIVE LLNSLH+LPSR Q +NIL+DVSGII Sbjct: 106 TIEVRFEHLNIEAEAHVGSISLPTFTNFMVNIVESLLNSLHVLPSRKQRLNILKDVSGII 165 Query: 181 KPSRMTLLLGPPSSGKTTLLLALA 252 KPSRMTLLLGPPSSGKTTLLLALA Sbjct: 166 KPSRMTLLLGPPSSGKTTLLLALA 189