BLASTX nr result
ID: Glycyrrhiza23_contig00011582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00011582 (425 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004142891.1| PREDICTED: U-box domain-containing protein 4... 92 3e-17 ref|XP_003557013.1| PREDICTED: U-box domain-containing protein 4... 91 1e-16 ref|XP_003550308.1| PREDICTED: U-box domain-containing protein 4... 91 1e-16 dbj|BAM15891.1| putative E3 ubiquitin ligase, partial [Pyrus pyr... 84 9e-15 ref|XP_002510099.1| E3 ubiquitin ligase PUB14, putative [Ricinus... 84 9e-15 >ref|XP_004142891.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus] gi|449482708|ref|XP_004156379.1| PREDICTED: U-box domain-containing protein 4-like [Cucumis sativus] Length = 352 Score = 92.4 bits (228), Expect = 3e-17 Identities = 47/54 (87%), Positives = 50/54 (92%) Frame = -2 Query: 424 VVYRTMVCREGAIPPLVALTQSGTNRAKQKAEKLIELLRQPRSGNAAARTSQMS 263 V+YRTMV REGAIPPLVAL+QSGTNRAKQKAEKLIELLRQPRSGN AA TS +S Sbjct: 298 VLYRTMVAREGAIPPLVALSQSGTNRAKQKAEKLIELLRQPRSGNYAATTSDVS 351 >ref|XP_003557013.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Length = 319 Score = 90.5 bits (223), Expect = 1e-16 Identities = 46/55 (83%), Positives = 49/55 (89%) Frame = -2 Query: 424 VVYRTMVCREGAIPPLVALTQSGTNRAKQKAEKLIELLRQPRSGNAAARTSQMSA 260 V YRTMV REGAIPPLVAL+QSGTNRAKQKAEKLIELLRQPRSG A RTS++ A Sbjct: 265 VAYRTMVAREGAIPPLVALSQSGTNRAKQKAEKLIELLRQPRSGYGAVRTSEVVA 319 >ref|XP_003550308.1| PREDICTED: U-box domain-containing protein 4-like [Glycine max] Length = 352 Score = 90.5 bits (223), Expect = 1e-16 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = -2 Query: 424 VVYRTMVCREGAIPPLVALTQSGTNRAKQKAEKLIELLRQPRSGNAAARTS 272 V YRTMV REGAIPPLVAL+QSGTNRAKQKAEKLIELLRQPRSGN AAR++ Sbjct: 297 VTYRTMVAREGAIPPLVALSQSGTNRAKQKAEKLIELLRQPRSGNGAARST 347 >dbj|BAM15891.1| putative E3 ubiquitin ligase, partial [Pyrus pyrifolia var. culta] Length = 119 Score = 84.3 bits (207), Expect = 9e-15 Identities = 43/53 (81%), Positives = 46/53 (86%) Frame = -2 Query: 421 VYRTMVCREGAIPPLVALTQSGTNRAKQKAEKLIELLRQPRSGNAAARTSQMS 263 V+R MV REGAIPPLVAL+QSGTNRAKQKAE L ELLRQPRSGN AAR S +S Sbjct: 66 VHRNMVAREGAIPPLVALSQSGTNRAKQKAETLTELLRQPRSGNFAARASDVS 118 >ref|XP_002510099.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] gi|223550800|gb|EEF52286.1| E3 ubiquitin ligase PUB14, putative [Ricinus communis] Length = 352 Score = 84.3 bits (207), Expect = 9e-15 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = -2 Query: 415 RTMVCREGAIPPLVALTQSGTNRAKQKAEKLIELLRQPRSGNAAARTSQMS 263 R MV REGAIPPL+AL+QSGTNRAKQKAE LI+LLRQPRSGNAAART +S Sbjct: 301 RAMVVREGAIPPLIALSQSGTNRAKQKAETLIDLLRQPRSGNAAARTPDVS 351