BLASTX nr result
ID: Glycyrrhiza23_contig00011242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00011242 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003600869.1| hypothetical protein MTR_3g070270 [Medicago ... 71 8e-11 >ref|XP_003600869.1| hypothetical protein MTR_3g070270 [Medicago truncatula] gi|355489917|gb|AES71120.1| hypothetical protein MTR_3g070270 [Medicago truncatula] Length = 271 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = +1 Query: 142 KAKENSDAPSNSALPLILISRVLKGIPQSPHFFHLRRFSELVR 270 K +ENSDAPSNS LPLI ISRVLKGIPQSPH+F LR +SEL R Sbjct: 92 KLQENSDAPSNSPLPLIKISRVLKGIPQSPHYFQLRNYSELAR 134