BLASTX nr result
ID: Glycyrrhiza23_contig00011241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00011241 (1253 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADL36811.1| NAC domain class transcription factor [Malus x do... 71 7e-10 ref|XP_002532627.1| conserved hypothetical protein [Ricinus comm... 70 9e-10 ref|XP_002311983.1| NAC domain protein, IPR003441 [Populus trich... 68 4e-09 ref|XP_002265345.2| PREDICTED: NAC domain-containing protein 78-... 68 4e-09 emb|CAN70406.1| hypothetical protein VITISV_021988 [Vitis vinifera] 68 4e-09 >gb|ADL36811.1| NAC domain class transcription factor [Malus x domestica] Length = 607 Score = 70.9 bits (172), Expect = 7e-10 Identities = 31/44 (70%), Positives = 36/44 (81%) Frame = +3 Query: 531 KKYGNGSKTNCPTERGYWKTTSKDRSIKHNNHNVGMKKTLVITS 662 KKYGN S+TN TE+GYWKTT KDR +KHN+ +VGMKKTLV S Sbjct: 75 KKYGNSSRTNRATEKGYWKTTGKDRPVKHNSRDVGMKKTLVFHS 118 >ref|XP_002532627.1| conserved hypothetical protein [Ricinus communis] gi|223527647|gb|EEF29758.1| conserved hypothetical protein [Ricinus communis] Length = 514 Score = 70.5 bits (171), Expect = 9e-10 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 531 KKYGNGSKTNCPTERGYWKTTSKDRSIKHNNHNVGMKKTLV 653 KKYGNGSKTN TE+GYWKTT KDR ++ N+ NVGMKKTLV Sbjct: 77 KKYGNGSKTNRATEKGYWKTTGKDRPVRWNSRNVGMKKTLV 117 >ref|XP_002311983.1| NAC domain protein, IPR003441 [Populus trichocarpa] gi|222851803|gb|EEE89350.1| NAC domain protein, IPR003441 [Populus trichocarpa] Length = 565 Score = 68.2 bits (165), Expect = 4e-09 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = +3 Query: 531 KKYGNGSKTNCPTERGYWKTTSKDRSIKHNNHNVGMKKTLV 653 KKYGNGSKTN TE+GYWKTT KDR I+ N+ VGMKKTLV Sbjct: 76 KKYGNGSKTNRATEKGYWKTTGKDRPIRQNSQVVGMKKTLV 116 >ref|XP_002265345.2| PREDICTED: NAC domain-containing protein 78-like [Vitis vinifera] gi|296085948|emb|CBI31389.3| unnamed protein product [Vitis vinifera] Length = 559 Score = 68.2 bits (165), Expect = 4e-09 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = +3 Query: 531 KKYGNGSKTNCPTERGYWKTTSKDRSIKHNNHNVGMKKTLVITS 662 KKYGNGS+TN T+RGYWKTT KDR ++H VGMKKTLV S Sbjct: 75 KKYGNGSRTNRATDRGYWKTTGKDREVRHRARTVGMKKTLVYHS 118 >emb|CAN70406.1| hypothetical protein VITISV_021988 [Vitis vinifera] Length = 573 Score = 68.2 bits (165), Expect = 4e-09 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = +3 Query: 531 KKYGNGSKTNCPTERGYWKTTSKDRSIKHNNHNVGMKKTLVITS 662 KKYGNGS+TN T+RGYWKTT KDR ++H VGMKKTLV S Sbjct: 75 KKYGNGSRTNRATDRGYWKTTGKDREVRHRARTVGMKKTLVYHS 118