BLASTX nr result
ID: Glycyrrhiza23_contig00011031
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00011031 (423 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003537977.1| PREDICTED: putative two-component response r... 110 9e-23 ref|XP_003539607.1| PREDICTED: putative two-component response r... 108 5e-22 ref|XP_002299857.1| predicted protein [Populus trichocarpa] gi|2... 91 1e-16 ref|XP_003606714.1| Two-component response regulator ARR1 [Medic... 89 5e-16 emb|CBI16094.3| unnamed protein product [Vitis vinifera] 85 7e-15 >ref|XP_003537977.1| PREDICTED: putative two-component response regulator ARR21-like [Glycine max] Length = 323 Score = 110 bits (276), Expect = 9e-23 Identities = 62/80 (77%), Positives = 64/80 (80%), Gaps = 9/80 (11%) Frame = -1 Query: 213 GLPSPHDLTPLSQLLIPPELASAFSISPEPRRTLLDVNRASRNTLSILRGGG----QAFS 46 GLP+ +DLTPLSQ LIPPELASAFSI PEP RTLLDVNRASRNTLS LRGGG QAFS Sbjct: 21 GLPTANDLTPLSQPLIPPELASAFSILPEPHRTLLDVNRASRNTLSTLRGGGGSVHQAFS 80 Query: 45 SSNNNH-----PDGGDEEEE 1 SSNNNH DGG EEEE Sbjct: 81 SSNNNHNYDGDGDGGVEEEE 100 >ref|XP_003539607.1| PREDICTED: putative two-component response regulator ARR21-like isoform 1 [Glycine max] gi|356542302|ref|XP_003539608.1| PREDICTED: putative two-component response regulator ARR21-like isoform 2 [Glycine max] Length = 306 Score = 108 bits (270), Expect = 5e-22 Identities = 59/79 (74%), Positives = 65/79 (82%), Gaps = 9/79 (11%) Frame = -1 Query: 213 GLPSPHDLTPLSQLLIPPELASAFSISPEPRRTLLDVNRASRNTLSILRGGG---QAFSS 43 GLP+ +DLTPLSQ LIPPELASAFSISPEP RTLL+VNRASRNTLS +RGGG QAFSS Sbjct: 21 GLPTANDLTPLSQPLIPPELASAFSISPEPHRTLLEVNRASRNTLSTIRGGGSVHQAFSS 80 Query: 42 SNNNH------PDGGDEEE 4 +NNN+ DGGDEEE Sbjct: 81 NNNNNHHYDGDGDGGDEEE 99 >ref|XP_002299857.1| predicted protein [Populus trichocarpa] gi|222847115|gb|EEE84662.1| predicted protein [Populus trichocarpa] Length = 186 Score = 90.5 bits (223), Expect = 1e-16 Identities = 46/59 (77%), Positives = 51/59 (86%) Frame = -1 Query: 213 GLPSPHDLTPLSQLLIPPELASAFSISPEPRRTLLDVNRASRNTLSILRGGGQAFSSSN 37 GLP+P+DLTPLSQLLIPPELASAF+ISPEP RT LDVNRAS+NTLS L G A SS+N Sbjct: 11 GLPTPYDLTPLSQLLIPPELASAFNISPEPHRTPLDVNRASQNTLSNLHGHLNALSSNN 69 >ref|XP_003606714.1| Two-component response regulator ARR1 [Medicago truncatula] gi|357472893|ref|XP_003606731.1| Two-component response regulator ARR1 [Medicago truncatula] gi|355507769|gb|AES88911.1| Two-component response regulator ARR1 [Medicago truncatula] gi|355507786|gb|AES88928.1| Two-component response regulator ARR1 [Medicago truncatula] Length = 312 Score = 88.6 bits (218), Expect = 5e-16 Identities = 44/61 (72%), Positives = 48/61 (78%) Frame = -1 Query: 216 KGLPSPHDLTPLSQLLIPPELASAFSISPEPRRTLLDVNRASRNTLSILRGGGQAFSSSN 37 KGLP+ HDLTPLS LIPPELASAFSISPEP RTL DVNRASRNTLS+LR ++ Sbjct: 17 KGLPNLHDLTPLSMALIPPELASAFSISPEPHRTLFDVNRASRNTLSLLRSNSGTITNQI 76 Query: 36 N 34 N Sbjct: 77 N 77 >emb|CBI16094.3| unnamed protein product [Vitis vinifera] Length = 395 Score = 84.7 bits (208), Expect = 7e-15 Identities = 42/59 (71%), Positives = 50/59 (84%) Frame = -1 Query: 213 GLPSPHDLTPLSQLLIPPELASAFSISPEPRRTLLDVNRASRNTLSILRGGGQAFSSSN 37 GLP+ DLTPLSQ LIPPELASAFSI+PEP RTLL+VNRAS++T S +RG +FSS+N Sbjct: 138 GLPAADDLTPLSQPLIPPELASAFSITPEPCRTLLEVNRASQSTFSTIRGQSHSFSSNN 196