BLASTX nr result
ID: Glycyrrhiza23_contig00010717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00010717 (305 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314711.1| predicted protein [Populus trichocarpa] gi|2... 72 6e-11 ref|XP_003610689.1| hypothetical protein MTR_5g005960 [Medicago ... 70 2e-10 ref|XP_002517210.1| conserved hypothetical protein [Ricinus comm... 70 2e-10 ref|XP_003538639.1| PREDICTED: probable membrane-associated kina... 67 2e-09 ref|XP_004140153.1| PREDICTED: probable membrane-associated kina... 66 3e-09 >ref|XP_002314711.1| predicted protein [Populus trichocarpa] gi|222863751|gb|EEF00882.1| predicted protein [Populus trichocarpa] Length = 365 Score = 71.6 bits (174), Expect = 6e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +2 Query: 203 PRKSSTTLCPADELFYKGQLLPLHLNPRISMVRT 304 PRKSSTTLCPADELFYKGQLLPLHL+PRISMVRT Sbjct: 40 PRKSSTTLCPADELFYKGQLLPLHLSPRISMVRT 73 >ref|XP_003610689.1| hypothetical protein MTR_5g005960 [Medicago truncatula] gi|355512024|gb|AES93647.1| hypothetical protein MTR_5g005960 [Medicago truncatula] Length = 353 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +2 Query: 203 PRKSSTTLCPADELFYKGQLLPLHLNPRISMVRT 304 PRKSS TLCPADELFYKGQLLPLHL+PRISMVRT Sbjct: 51 PRKSSNTLCPADELFYKGQLLPLHLSPRISMVRT 84 >ref|XP_002517210.1| conserved hypothetical protein [Ricinus communis] gi|223543845|gb|EEF45373.1| conserved hypothetical protein [Ricinus communis] Length = 350 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +2 Query: 203 PRKSSTTLCPADELFYKGQLLPLHLNPRISMVRT 304 PRKSST LCPADELFYKGQLLPLHL+PRISMVRT Sbjct: 40 PRKSSTALCPADELFYKGQLLPLHLSPRISMVRT 73 >ref|XP_003538639.1| PREDICTED: probable membrane-associated kinase regulator 1-like [Glycine max] Length = 367 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = +2 Query: 203 PRKSSTTLCPADELFYKGQLLPLHLNPRISMVRT 304 PRKSST LCPADELFYKGQLLPLHL+ RISMVRT Sbjct: 47 PRKSSTALCPADELFYKGQLLPLHLSQRISMVRT 80 >ref|XP_004140153.1| PREDICTED: probable membrane-associated kinase regulator 1-like [Cucumis sativus] gi|449512866|ref|XP_004164164.1| PREDICTED: probable membrane-associated kinase regulator 1-like [Cucumis sativus] Length = 360 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +2 Query: 203 PRKSSTTLCPADELFYKGQLLPLHLNPRISMVRT 304 PR++ST LCPADELFYKGQLLPLHL+PR+SMVRT Sbjct: 39 PRQASTALCPADELFYKGQLLPLHLSPRLSMVRT 72