BLASTX nr result
ID: Glycyrrhiza23_contig00010390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00010390 (846 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539732.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like ... 86 1e-14 ref|XP_003538048.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like ... 86 1e-14 ref|XP_002526365.1| sumo ligase, putative [Ricinus communis] gi|... 83 9e-14 ref|NP_974969.1| E3 SUMO-protein ligase SIZ1 [Arabidopsis thalia... 80 4e-13 dbj|BAD43867.1| putative protein [Arabidopsis thaliana] 80 4e-13 >ref|XP_003539732.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like [Glycine max] Length = 880 Score = 85.9 bits (211), Expect = 1e-14 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +3 Query: 3 LLLGMNDVRSDKASRQRSDSPFSFPRQKRSVRPRLYLSIDSDSE 134 LLLGMNDVRSD+A RQRSDSPFSFPRQKRSVRPRLYLSIDSDSE Sbjct: 837 LLLGMNDVRSDRARRQRSDSPFSFPRQKRSVRPRLYLSIDSDSE 880 >ref|XP_003538048.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like [Glycine max] Length = 879 Score = 85.9 bits (211), Expect = 1e-14 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = +3 Query: 3 LLLGMNDVRSDKASRQRSDSPFSFPRQKRSVRPRLYLSIDSDSE 134 LLLGMNDVRSD+A RQRSDSPFSFPRQKRSVRPRLYLSIDSDSE Sbjct: 836 LLLGMNDVRSDRARRQRSDSPFSFPRQKRSVRPRLYLSIDSDSE 879 >ref|XP_002526365.1| sumo ligase, putative [Ricinus communis] gi|223534324|gb|EEF36036.1| sumo ligase, putative [Ricinus communis] Length = 876 Score = 82.8 bits (203), Expect = 9e-14 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +3 Query: 3 LLLGMNDVRSDKASRQRSDSPFSFPRQKRSVRPRLYLSIDSDSE 134 LLLGMND RS+KASRQRSDSPF FPRQKRS+RPRLYLSIDSDSE Sbjct: 833 LLLGMNDGRSEKASRQRSDSPFQFPRQKRSIRPRLYLSIDSDSE 876 >ref|NP_974969.1| E3 SUMO-protein ligase SIZ1 [Arabidopsis thaliana] gi|186532611|ref|NP_001119465.1| E3 SUMO-protein ligase SIZ1 [Arabidopsis thaliana] gi|332009941|gb|AED97324.1| E3 SUMO-protein ligase SIZ1 [Arabidopsis thaliana] gi|332009945|gb|AED97328.1| E3 SUMO-protein ligase SIZ1 [Arabidopsis thaliana] Length = 885 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +3 Query: 3 LLLGMNDVRSDKASRQRSDSPFSFPRQKRSVRPRLYLSIDSDSE 134 LLLGMND R DKA +QRSD+PFSFPRQKRSVRPR+YLSIDSDSE Sbjct: 830 LLLGMNDSRQDKAKKQRSDNPFSFPRQKRSVRPRMYLSIDSDSE 873 >dbj|BAD43867.1| putative protein [Arabidopsis thaliana] Length = 885 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +3 Query: 3 LLLGMNDVRSDKASRQRSDSPFSFPRQKRSVRPRLYLSIDSDSE 134 LLLGMND R DKA +QRSD+PFSFPRQKRSVRPR+YLSIDSDSE Sbjct: 830 LLLGMNDSRQDKAKKQRSDNPFSFPRQKRSVRPRMYLSIDSDSE 873