BLASTX nr result
ID: Glycyrrhiza23_contig00010155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00010155 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003546357.1| PREDICTED: probable histone-arginine methylt... 55 8e-06 >ref|XP_003546357.1| PREDICTED: probable histone-arginine methyltransferase 1.4-like [Glycine max] Length = 544 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 2 IQSRDLDEAEILQQPSPNSCAQIDSFMQNA 91 IQS+DLDE EI+QQPSP SCAQIDS MQNA Sbjct: 514 IQSQDLDEVEIMQQPSPKSCAQIDSLMQNA 543