BLASTX nr result
ID: Glycyrrhiza23_contig00008907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00008907 (569 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003628798.1| hypothetical protein MTR_8g066850 [Medicago ... 56 4e-06 >ref|XP_003628798.1| hypothetical protein MTR_8g066850 [Medicago truncatula] gi|355522820|gb|AET03274.1| hypothetical protein MTR_8g066850 [Medicago truncatula] Length = 298 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -2 Query: 217 MATSRVLSIVLFVSLGLGICSAARTLLTYGSDEHGNSAGFH 95 MATS+VLSI+ FV LG GICSAARTLLT+G D H AG+H Sbjct: 1 MATSKVLSILFFVLLGFGICSAARTLLTFGVD-HRIGAGYH 40