BLASTX nr result
ID: Glycyrrhiza23_contig00008725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00008725 (744 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615404.1| hypothetical protein MTR_5g067520 [Medicago ... 69 1e-09 ref|XP_003619149.1| hypothetical protein MTR_6g042730 [Medicago ... 60 2e-07 ref|XP_003609362.1| hypothetical protein MTR_4g114840 [Medicago ... 58 2e-06 ref|XP_003590939.1| hypothetical protein MTR_1g079880 [Medicago ... 56 7e-06 >ref|XP_003615404.1| hypothetical protein MTR_5g067520 [Medicago truncatula] gi|355516739|gb|AES98362.1| hypothetical protein MTR_5g067520 [Medicago truncatula] Length = 66 Score = 68.6 bits (166), Expect = 1e-09 Identities = 35/64 (54%), Positives = 43/64 (67%), Gaps = 1/64 (1%) Frame = +1 Query: 343 WASTL*IQRHGYSSHFDFVT-FVSILPCYAINLGTVNLFADLSFSVFSDVEFVLLSMYFT 519 WASTL IQ+HGY DF+ FV I P YAINLG V+LFAD ++ + + +L MYF Sbjct: 3 WASTLQIQKHGYFGDLDFIILFVDIFPLYAINLGAVSLFADSPYTFLAILIMLLSLMYFI 62 Query: 520 NLNE 531 NLNE Sbjct: 63 NLNE 66 >ref|XP_003619149.1| hypothetical protein MTR_6g042730 [Medicago truncatula] gi|355494164|gb|AES75367.1| hypothetical protein MTR_6g042730 [Medicago truncatula] Length = 65 Score = 60.1 bits (144), Expect(2) = 2e-07 Identities = 32/59 (54%), Positives = 40/59 (67%), Gaps = 1/59 (1%) Frame = +1 Query: 343 WASTL*IQRHGYSSHFDFVT-FVSILPCYAINLGTVNLFADLSFSVFSDVEFVLLSMYF 516 WASTL IQ++ Y DF+ FV ILP YAINL V+LFAD + VFSD+ V++S F Sbjct: 3 WASTLQIQKNVYFGDLDFIILFVGILPLYAINLDAVSLFADSLYYVFSDINHVIVSDVF 61 Score = 21.6 bits (44), Expect(2) = 2e-07 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +3 Query: 498 VVIDVFYQFE 527 +V DVFYQFE Sbjct: 56 IVSDVFYQFE 65 >ref|XP_003609362.1| hypothetical protein MTR_4g114840 [Medicago truncatula] gi|355510417|gb|AES91559.1| hypothetical protein MTR_4g114840 [Medicago truncatula] Length = 62 Score = 57.8 bits (138), Expect = 2e-06 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = +1 Query: 343 WASTL*IQRHGYSSHFDFVT-FVSILPCYAINLGTVNLFADLSFSVFSDVEFVLLSMYFT 519 W STL IQ+ YS D++ FV ILP YAINLG V+LFAD F+ + +L+ MY Sbjct: 3 WTSTLQIQKQEYSGDLDYIILFVGILPLYAINLGAVSLFADSFFTFLA----ILILMYSI 58 Query: 520 NLNE 531 +LNE Sbjct: 59 DLNE 62 >ref|XP_003590939.1| hypothetical protein MTR_1g079880 [Medicago truncatula] gi|355479987|gb|AES61190.1| hypothetical protein MTR_1g079880 [Medicago truncatula] Length = 61 Score = 56.2 bits (134), Expect = 7e-06 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 1/45 (2%) Frame = +1 Query: 343 WASTL*IQRHGYSSHFDFVT-FVSILPCYAINLGTVNLFADLSFS 474 W STL I++HGY F F+ FVSILP YAINLG V+LFAD F+ Sbjct: 3 WTSTLQIRKHGYFGDFGFIILFVSILPLYAINLGVVSLFADSPFT 47