BLASTX nr result
ID: Glycyrrhiza23_contig00008466
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00008466 (565 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003534195.1| PREDICTED: uncharacterized protein LOC100306... 56 4e-06 ref|XP_003629641.1| hypothetical protein MTR_8g083450 [Medicago ... 56 4e-06 ref|XP_003530613.1| PREDICTED: uncharacterized protein LOC100500... 56 5e-06 ref|XP_003525269.1| PREDICTED: uncharacterized protein LOC100819... 55 8e-06 >ref|XP_003534195.1| PREDICTED: uncharacterized protein LOC100306261 [Glycine max] gi|255628035|gb|ACU14362.1| unknown [Glycine max] Length = 82 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 Query: 565 QCLCSPTTHEGSFRCRLHRGSNSTPTTPPAWM 470 QCLCSPTTHEGSFRCRLHRG ++PT WM Sbjct: 36 QCLCSPTTHEGSFRCRLHRGPTASPTN---WM 64 >ref|XP_003629641.1| hypothetical protein MTR_8g083450 [Medicago truncatula] gi|357521029|ref|XP_003630803.1| hypothetical protein MTR_8g103590 [Medicago truncatula] gi|355523663|gb|AET04117.1| hypothetical protein MTR_8g083450 [Medicago truncatula] gi|355524825|gb|AET05279.1| hypothetical protein MTR_8g103590 [Medicago truncatula] Length = 102 Score = 56.2 bits (134), Expect = 4e-06 Identities = 21/32 (65%), Positives = 25/32 (78%) Frame = -1 Query: 565 QCLCSPTTHEGSFRCRLHRGSNSTPTTPPAWM 470 +CLCSPTTHEGSFRCR HR + + + PP WM Sbjct: 51 RCLCSPTTHEGSFRCRFHRSGSFSSSAPPPWM 82 >ref|XP_003530613.1| PREDICTED: uncharacterized protein LOC100500563 [Glycine max] gi|255630637|gb|ACU15678.1| unknown [Glycine max] Length = 69 Score = 55.8 bits (133), Expect = 5e-06 Identities = 22/32 (68%), Positives = 28/32 (87%) Frame = -1 Query: 565 QCLCSPTTHEGSFRCRLHRGSNSTPTTPPAWM 470 QCLCSPTTHEGSFRCR HR + ++ ++PP+WM Sbjct: 33 QCLCSPTTHEGSFRCRFHRSATAS-SSPPSWM 63 >ref|XP_003525269.1| PREDICTED: uncharacterized protein LOC100819326 [Glycine max] Length = 67 Score = 55.1 bits (131), Expect = 8e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 565 QCLCSPTTHEGSFRCRLHRGSNSTPTTPPAWM 470 QCLCSPTTHEGSFRCR HR S + ++PP+WM Sbjct: 31 QCLCSPTTHEGSFRCRFHR-SVAASSSPPSWM 61