BLASTX nr result
ID: Glycyrrhiza23_contig00008053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00008053 (270 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003637522.1| Mutant low phytic acid protein [Medicago tru... 115 5e-24 ref|XP_003596767.1| hypothetical protein MTR_2g085410 [Medicago ... 115 5e-24 ref|XP_003638077.1| 2-phosphoglycerate kinase [Medicago truncatu... 109 2e-22 ref|XP_002534208.1| conserved hypothetical protein [Ricinus comm... 98 8e-19 ref|XP_003538154.1| PREDICTED: uncharacterized protein DDB_G0273... 97 1e-18 >ref|XP_003637522.1| Mutant low phytic acid protein [Medicago truncatula] gi|355503457|gb|AES84660.1| Mutant low phytic acid protein [Medicago truncatula] Length = 753 Score = 115 bits (287), Expect = 5e-24 Identities = 63/80 (78%), Positives = 67/80 (83%), Gaps = 2/80 (2%) Frame = +2 Query: 2 GNKYRQNLDLFLRTRSEPVP--VASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIP 175 G KYRQNLD FLRTRSEPVP VAS EP C+Y S L EKSE+KLS +G+ KLRKRSLSIP Sbjct: 676 GIKYRQNLDQFLRTRSEPVPIAVASQEPFCAYPSLLAEKSEKKLSSNGRAKLRKRSLSIP 735 Query: 176 ALGKHSSAINDPILSGAPQR 235 ALGKHSSA DPILSGAPQR Sbjct: 736 ALGKHSSA--DPILSGAPQR 753 >ref|XP_003596767.1| hypothetical protein MTR_2g085410 [Medicago truncatula] gi|355485815|gb|AES67018.1| hypothetical protein MTR_2g085410 [Medicago truncatula] Length = 343 Score = 115 bits (287), Expect = 5e-24 Identities = 63/80 (78%), Positives = 67/80 (83%), Gaps = 2/80 (2%) Frame = +2 Query: 2 GNKYRQNLDLFLRTRSEPVP--VASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIP 175 G KYRQNLD FLRTRSEPVP VAS EP C+Y S L EKSE+KLS +G+ KLRKRSLSIP Sbjct: 266 GIKYRQNLDQFLRTRSEPVPIAVASQEPFCAYPSLLAEKSEKKLSSNGRAKLRKRSLSIP 325 Query: 176 ALGKHSSAINDPILSGAPQR 235 ALGKHSSA DPILSGAPQR Sbjct: 326 ALGKHSSA--DPILSGAPQR 343 >ref|XP_003638077.1| 2-phosphoglycerate kinase [Medicago truncatula] gi|355504012|gb|AES85215.1| 2-phosphoglycerate kinase [Medicago truncatula] Length = 601 Score = 109 bits (273), Expect = 2e-22 Identities = 57/76 (75%), Positives = 63/76 (82%) Frame = +2 Query: 2 GNKYRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPAL 181 G KYRQNLDLFLRTRSEPVP E +CSYSS L+EK+ER+L PSGK KLRKRSLSI AL Sbjct: 530 GIKYRQNLDLFLRTRSEPVP----ESLCSYSSLLMEKAERRLPPSGKAKLRKRSLSISAL 585 Query: 182 GKHSSAINDPILSGAP 229 GK SS + DPI+SGAP Sbjct: 586 GKGSSTVQDPIISGAP 601 >ref|XP_002534208.1| conserved hypothetical protein [Ricinus communis] gi|223525703|gb|EEF28172.1| conserved hypothetical protein [Ricinus communis] Length = 716 Score = 97.8 bits (242), Expect = 8e-19 Identities = 49/78 (62%), Positives = 59/78 (75%) Frame = +2 Query: 2 GNKYRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPAL 181 G+KY QNLD FLRTRSEP+ EP+C+YSS L EK R++S SG K+R+RSLSIPA+ Sbjct: 643 GDKYMQNLDRFLRTRSEPLA----EPLCAYSSLLAEKGGRRMSNSGSGKMRRRSLSIPAI 698 Query: 182 GKHSSAINDPILSGAPQR 235 GKH S + PILSGAP R Sbjct: 699 GKHGSEVAGPILSGAPHR 716 >ref|XP_003538154.1| PREDICTED: uncharacterized protein DDB_G0273453/DDB_G0273565-like [Glycine max] Length = 704 Score = 97.4 bits (241), Expect = 1e-18 Identities = 53/78 (67%), Positives = 60/78 (76%) Frame = +2 Query: 2 GNKYRQNLDLFLRTRSEPVPVASPEPICSYSSWLLEKSERKLSPSGKDKLRKRSLSIPAL 181 G KYR+NLD+FLR+RSE EP+CSYSS L+EK+ERK KLR RSLSIPAL Sbjct: 638 GYKYRRNLDIFLRSRSELA-----EPLCSYSSLLVEKNERK------SKLRTRSLSIPAL 686 Query: 182 GKHSSAINDPILSGAPQR 235 GKH SA+NDPILSGAPQR Sbjct: 687 GKHRSAVNDPILSGAPQR 704