BLASTX nr result
ID: Glycyrrhiza23_contig00007640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00007640 (915 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539889.1| PREDICTED: uncharacterized protein LOC100791... 74 6e-11 ref|NP_001119011.1| uncharacerized protein [Arabidopsis thaliana... 59 2e-06 >ref|XP_003539889.1| PREDICTED: uncharacterized protein LOC100791461 [Glycine max] Length = 41 Score = 73.6 bits (179), Expect = 6e-11 Identities = 30/41 (73%), Positives = 37/41 (90%) Frame = -1 Query: 681 MEGVLFWSSCHKYRLYSFQEVLEWRFFILGKFLRVSFVNCT 559 MEGV FW++C++YR ++FQEVL+WR FILG FLRVSFVNCT Sbjct: 1 MEGVCFWTNCYQYRFFAFQEVLDWRVFILGDFLRVSFVNCT 41 >ref|NP_001119011.1| uncharacerized protein [Arabidopsis thaliana] gi|332658744|gb|AEE84144.1| uncharacerized protein [Arabidopsis thaliana] Length = 41 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/41 (60%), Positives = 29/41 (70%) Frame = -1 Query: 681 MEGVLFWSSCHKYRLYSFQEVLEWRFFILGKFLRVSFVNCT 559 ME V W SC+ YRL+SFQE L+WRF + FL SFVNCT Sbjct: 1 MEQVFVWPSCYHYRLFSFQEALDWRFLVRSDFLVGSFVNCT 41