BLASTX nr result
ID: Glycyrrhiza23_contig00007212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00007212 (424 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512064.1| ubiquinone biosynthesis protein, putative [R... 112 3e-23 ref|XP_002520520.1| ubiquinone biosynthesis protein, putative [R... 112 3e-23 ref|XP_004166869.1| PREDICTED: ubiquinone biosynthesis protein C... 105 3e-21 ref|XP_002285502.1| PREDICTED: ubiquinone biosynthesis protein C... 105 4e-21 ref|XP_004144164.1| PREDICTED: ubiquinone biosynthesis protein C... 104 7e-21 >ref|XP_002512064.1| ubiquinone biosynthesis protein, putative [Ricinus communis] gi|223549244|gb|EEF50733.1| ubiquinone biosynthesis protein, putative [Ricinus communis] Length = 199 Score = 112 bits (280), Expect = 3e-23 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = +3 Query: 3 FSEKQRKLFYQHYFPWAVRAGMQCTDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 167 F+EKQRKLF QHYFPWAVRAGMQCTDLMCVYYE+HFHEDL+DVRRKL I+PAPAV Sbjct: 139 FNEKQRKLFLQHYFPWAVRAGMQCTDLMCVYYEKHFHEDLDDVRRKLGIIPAPAV 193 >ref|XP_002520520.1| ubiquinone biosynthesis protein, putative [Ricinus communis] gi|223540362|gb|EEF41933.1| ubiquinone biosynthesis protein, putative [Ricinus communis] Length = 230 Score = 112 bits (280), Expect = 3e-23 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = +3 Query: 3 FSEKQRKLFYQHYFPWAVRAGMQCTDLMCVYYERHFHEDLEDVRRKLQIVPAPAV 167 F+EKQRKLF QHYFPWAVRAGMQCTDLMCVYYE+HFHEDL+DVRRKL I+PAPAV Sbjct: 170 FNEKQRKLFLQHYFPWAVRAGMQCTDLMCVYYEKHFHEDLDDVRRKLGIIPAPAV 224 >ref|XP_004166869.1| PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial-like isoform 1 [Cucumis sativus] gi|449519695|ref|XP_004166870.1| PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial-like isoform 2 [Cucumis sativus] Length = 226 Score = 105 bits (263), Expect = 3e-21 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = +3 Query: 3 FSEKQRKLFYQHYFPWAVRAGMQCTDLMCVYYERHFHEDLEDVRRKLQIVPAP 161 FSEKQRKLF+QHYFPW++RAGMQCTDLMC+YYERHFHEDL DVR K I+PAP Sbjct: 169 FSEKQRKLFFQHYFPWSIRAGMQCTDLMCIYYERHFHEDLNDVRAKWGIIPAP 221 >ref|XP_002285502.1| PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial [Vitis vinifera] Length = 227 Score = 105 bits (262), Expect = 4e-21 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = +3 Query: 3 FSEKQRKLFYQHYFPWAVRAGMQCTDLMCVYYERHFHEDLEDVRRKLQIVPAP 161 FSEKQR LF+QHYFPWA RAGMQCTDLMC+YYE+HFHEDL+DVRRK IVPAP Sbjct: 170 FSEKQRALFFQHYFPWATRAGMQCTDLMCIYYEQHFHEDLDDVRRKWGIVPAP 222 >ref|XP_004144164.1| PREDICTED: ubiquinone biosynthesis protein COQ4 homolog, mitochondrial-like [Cucumis sativus] Length = 226 Score = 104 bits (260), Expect = 7e-21 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = +3 Query: 3 FSEKQRKLFYQHYFPWAVRAGMQCTDLMCVYYERHFHEDLEDVRRKLQIVPAP 161 F+EKQRKLF+QHYFPW++RAGMQCTDLMC+YYERHFHEDL DVR K I+PAP Sbjct: 169 FNEKQRKLFFQHYFPWSIRAGMQCTDLMCIYYERHFHEDLNDVRAKWGIIPAP 221