BLASTX nr result
ID: Glycyrrhiza23_contig00006964
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00006964 (419 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003535855.1| PREDICTED: carboxyl-terminal-processing prot... 72 6e-11 >ref|XP_003535855.1| PREDICTED: carboxyl-terminal-processing protease-like [Glycine max] Length = 508 Score = 71.6 bits (174), Expect = 6e-11 Identities = 47/98 (47%), Positives = 63/98 (64%), Gaps = 1/98 (1%) Frame = -1 Query: 293 LCQNMDVKTTMIPGNIKVGKPN-WVLAGGVFPRRLWFPTTWKRKVSVEVEEAKLKVEGAS 117 LCQN DV+ T IP +K+GK + W + +FPRRLW PT W E + LKV+ + Sbjct: 4 LCQNFDVRAT-IP--VKIGKKSTWDV---LFPRRLWLPT-WTCDQRKE-GKLNLKVQCGT 55 Query: 116 ASAGWNLESVVKSAFGFGVSAALSFSLLCHASPSLAQS 3 GW +ES KSAFGFGVSAA+ FS+ C++ +LA+S Sbjct: 56 RKEGW-VESAGKSAFGFGVSAAVLFSVFCYSPAALAES 92