BLASTX nr result
ID: Glycyrrhiza23_contig00006905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00006905 (451 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004143524.1| PREDICTED: soluble inorganic pyrophosphatase... 70 2e-10 gb|AFK45917.1| unknown [Lotus japonicus] 68 9e-10 ref|XP_002521557.1| inorganic pyrophosphatase, putative [Ricinus... 67 2e-09 gb|AFK40071.1| unknown [Medicago truncatula] 66 3e-09 ref|NP_001238102.1| uncharacterized protein LOC100527574 [Glycin... 66 3e-09 >ref|XP_004143524.1| PREDICTED: soluble inorganic pyrophosphatase-like [Cucumis sativus] gi|449522764|ref|XP_004168396.1| PREDICTED: soluble inorganic pyrophosphatase-like [Cucumis sativus] Length = 239 Score = 69.7 bits (169), Expect = 2e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 449 NKKVDVEDFLPAQAAIDAINYSMDLYAAYIVESLRQ 342 NKKVDVEDFLPA+AAIDAI YSMDLYAAYIVESLRQ Sbjct: 204 NKKVDVEDFLPAEAAIDAIKYSMDLYAAYIVESLRQ 239 >gb|AFK45917.1| unknown [Lotus japonicus] Length = 216 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 449 NKKVDVEDFLPAQAAIDAINYSMDLYAAYIVESLRQ 342 NKKVDVEDFLPA+AA++AI YSMDLYAAYIVESLRQ Sbjct: 181 NKKVDVEDFLPAEAAVEAIKYSMDLYAAYIVESLRQ 216 >ref|XP_002521557.1| inorganic pyrophosphatase, putative [Ricinus communis] gi|223539235|gb|EEF40828.1| inorganic pyrophosphatase, putative [Ricinus communis] Length = 212 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 449 NKKVDVEDFLPAQAAIDAINYSMDLYAAYIVESLRQ 342 NKKVDVEDFLPA+AAI+AI YSMDLYA+YIVESLRQ Sbjct: 177 NKKVDVEDFLPAEAAINAIKYSMDLYASYIVESLRQ 212 >gb|AFK40071.1| unknown [Medicago truncatula] Length = 216 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = -3 Query: 449 NKKVDVEDFLPAQAAIDAINYSMDLYAAYIVESLRQ*LL 333 NKKVDV+DFLPA++A+DAI YSMDLYA+YIVESLR+ LL Sbjct: 178 NKKVDVDDFLPAESAVDAIKYSMDLYASYIVESLRKRLL 216 >ref|NP_001238102.1| uncharacterized protein LOC100527574 [Glycine max] gi|255632663|gb|ACU16683.1| unknown [Glycine max] Length = 213 Score = 65.9 bits (159), Expect = 3e-09 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -3 Query: 449 NKKVDVEDFLPAQAAIDAINYSMDLYAAYIVESLR 345 NK VDVEDFLPA+AAIDAINYSMDLYAAYIVESL+ Sbjct: 178 NKIVDVEDFLPAEAAIDAINYSMDLYAAYIVESLK 212