BLASTX nr result
ID: Glycyrrhiza23_contig00006429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00006429 (319 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q40194.1|RB11D_LOTJA RecName: Full=Ras-related protein Rab11D... 60 2e-07 ref|XP_003596706.1| Ras-related protein Rab-11A [Medicago trunca... 55 5e-06 >sp|Q40194.1|RB11D_LOTJA RecName: Full=Ras-related protein Rab11D gi|1370148|emb|CAA98180.1| RAB11D [Lotus japonicus] Length = 218 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/32 (81%), Positives = 32/32 (100%) Frame = -3 Query: 314 NAGASSGVPSKGQTINVKEDSSVLKRYGCCSS 219 ++G+SSG+PSKGQTINVKEDSSVLKR+GCCS+ Sbjct: 187 DSGSSSGLPSKGQTINVKEDSSVLKRFGCCST 218 >ref|XP_003596706.1| Ras-related protein Rab-11A [Medicago truncatula] gi|355485754|gb|AES66957.1| Ras-related protein Rab-11A [Medicago truncatula] Length = 218 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 308 GASSGVPSKGQTINVKEDSSVLKRYGCCSS 219 G+SS VPS GQTINVKEDSSVLKR+GCCS+ Sbjct: 189 GSSSSVPSVGQTINVKEDSSVLKRFGCCSN 218