BLASTX nr result
ID: Glycyrrhiza23_contig00006411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00006411 (527 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003613423.1| Two-component response regulator ARR3 [Medic... 101 8e-20 gb|ABN48988.1| type A response regulator RR1 [Phaseolus vulgaris] 100 1e-19 ref|XP_003519320.1| PREDICTED: two-component response regulator ... 99 3e-19 ref|XP_003517746.1| PREDICTED: two-component response regulator ... 98 7e-19 ref|NP_001238075.1| uncharacterized protein LOC100527828 [Glycin... 97 1e-18 >ref|XP_003613423.1| Two-component response regulator ARR3 [Medicago truncatula] gi|355514758|gb|AES96381.1| Two-component response regulator ARR3 [Medicago truncatula] Length = 237 Score = 101 bits (251), Expect = 8e-20 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +3 Query: 3 TFREIPVVIMSSENILPRIDRCLEEGAEDFIVKPVKLSDVKRLKGYMTTKE 155 TFR IPVVIMSSENILPRIDRCLEEGAEDFIVKPVKLSDVKRLKGYMTTKE Sbjct: 101 TFRAIPVVIMSSENILPRIDRCLEEGAEDFIVKPVKLSDVKRLKGYMTTKE 151 >gb|ABN48988.1| type A response regulator RR1 [Phaseolus vulgaris] Length = 227 Score = 100 bits (250), Expect = 1e-19 Identities = 55/73 (75%), Positives = 56/73 (76%), Gaps = 5/73 (6%) Frame = +3 Query: 6 FREIPVVIMSSENILPRIDRCLEEGAEDFIVKPVKLSDVKRLKGYMTTKE-----XXXXX 170 FREIPVVIMSSENILPRIDRCLEEGAEDFIVKPVKLSDVKRLKGYMTT+E Sbjct: 106 FREIPVVIMSSENILPRIDRCLEEGAEDFIVKPVKLSDVKRLKGYMTTREVKVGSHDRGS 165 Query: 171 XXXXXXKRKLPEE 209 KRKL EE Sbjct: 166 GVEINNKRKLEEE 178 >ref|XP_003519320.1| PREDICTED: two-component response regulator ARR3-like [Glycine max] Length = 240 Score = 99.4 bits (246), Expect = 3e-19 Identities = 49/50 (98%), Positives = 49/50 (98%) Frame = +3 Query: 6 FREIPVVIMSSENILPRIDRCLEEGAEDFIVKPVKLSDVKRLKGYMTTKE 155 FREIPVVIMSSENILPRIDRCLEEGAEDFIVKPVKLSDVKRLKGYMT KE Sbjct: 106 FREIPVVIMSSENILPRIDRCLEEGAEDFIVKPVKLSDVKRLKGYMTPKE 155 >ref|XP_003517746.1| PREDICTED: two-component response regulator ARR3-like [Glycine max] Length = 244 Score = 98.2 bits (243), Expect = 7e-19 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = +3 Query: 6 FREIPVVIMSSENILPRIDRCLEEGAEDFIVKPVKLSDVKRLKGYMTTKE 155 FREIPVVIMSSENILPRIDRCLEEGAEDFIVKPVKLSDVKRLKGY+T KE Sbjct: 106 FREIPVVIMSSENILPRIDRCLEEGAEDFIVKPVKLSDVKRLKGYLTPKE 155 >ref|NP_001238075.1| uncharacterized protein LOC100527828 [Glycine max] gi|255633320|gb|ACU17017.1| unknown [Glycine max] Length = 222 Score = 97.4 bits (241), Expect = 1e-18 Identities = 47/51 (92%), Positives = 49/51 (96%) Frame = +3 Query: 3 TFREIPVVIMSSENILPRIDRCLEEGAEDFIVKPVKLSDVKRLKGYMTTKE 155 TF+E PVVIMSSEN+LPRIDRCLEEGAEDFIVKPVKLSDVKRLK YMTTKE Sbjct: 114 TFKETPVVIMSSENVLPRIDRCLEEGAEDFIVKPVKLSDVKRLKDYMTTKE 164