BLASTX nr result
ID: Glycyrrhiza23_contig00006293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00006293 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003547826.1| PREDICTED: uncharacterized protein LOC100782... 62 5e-08 ref|XP_003528651.1| PREDICTED: uncharacterized protein LOC100812... 60 2e-07 >ref|XP_003547826.1| PREDICTED: uncharacterized protein LOC100782874 [Glycine max] Length = 370 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -2 Query: 134 FRRRAPAADSDSSEREAPSPVSSDSFPPESYERKRARAVMNPNA 3 FRRR P DSDS ER+A SP SSDSFPPES+ERKR R + + A Sbjct: 223 FRRRGPPVDSDSEERDASSPASSDSFPPESFERKRPRLMSSNTA 266 >ref|XP_003528651.1| PREDICTED: uncharacterized protein LOC100812599 [Glycine max] Length = 368 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 134 FRRRAPAADSDSSEREAPSPVSSDSFPPESYERKRAR 24 FRRR P +SDS ER+A SP SSDSFPPES+ERKR R Sbjct: 221 FRRRGPPVESDSEERDASSPASSDSFPPESFERKRPR 257