BLASTX nr result
ID: Glycyrrhiza23_contig00005742
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00005742 (790 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003538371.1| PREDICTED: FACT complex subunit SPT16-like [... 94 4e-17 ref|XP_003553020.1| PREDICTED: FACT complex subunit SPT16-like [... 93 6e-17 ref|XP_003552890.1| PREDICTED: FACT complex subunit SPT16-like [... 89 1e-15 ref|XP_003538372.1| PREDICTED: FACT complex subunit SPT16-like i... 89 1e-15 ref|XP_003618435.1| FACT complex subunit SPT16 [Medicago truncat... 89 1e-15 >ref|XP_003538371.1| PREDICTED: FACT complex subunit SPT16-like [Glycine max] Length = 1068 Score = 93.6 bits (231), Expect = 4e-17 Identities = 48/53 (90%), Positives = 50/53 (94%), Gaps = 1/53 (1%) Frame = +1 Query: 58 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSR-ASLSSSMPKRRKLR 213 TWEELEREASNADREKGNESDSE+DRKRRKAK+FG SR ASLSSSMPKR KLR Sbjct: 1016 TWEELEREASNADREKGNESDSEEDRKRRKAKSFGKSRGASLSSSMPKRSKLR 1068 >ref|XP_003553020.1| PREDICTED: FACT complex subunit SPT16-like [Glycine max] Length = 1068 Score = 93.2 bits (230), Expect = 6e-17 Identities = 48/53 (90%), Positives = 49/53 (92%), Gaps = 1/53 (1%) Frame = +1 Query: 58 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSR-ASLSSSMPKRRKLR 213 TWEELEREASNADREKGNESDSE+DRKRRKAK FG SR ASLSSSMPKR KLR Sbjct: 1016 TWEELEREASNADREKGNESDSEEDRKRRKAKGFGKSRGASLSSSMPKRSKLR 1068 >ref|XP_003552890.1| PREDICTED: FACT complex subunit SPT16-like [Glycine max] Length = 1064 Score = 88.6 bits (218), Expect = 1e-15 Identities = 46/53 (86%), Positives = 48/53 (90%), Gaps = 1/53 (1%) Frame = +1 Query: 58 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSR-ASLSSSMPKRRKLR 213 TWEELEREASNADREKGNESDSE+DRKRRKAK+FG SR A LSSSM KR KLR Sbjct: 1012 TWEELEREASNADREKGNESDSEEDRKRRKAKSFGKSRGAGLSSSMTKRPKLR 1064 >ref|XP_003538372.1| PREDICTED: FACT complex subunit SPT16-like isoform 1 [Glycine max] gi|356539783|ref|XP_003538373.1| PREDICTED: FACT complex subunit SPT16-like isoform 2 [Glycine max] Length = 1069 Score = 88.6 bits (218), Expect = 1e-15 Identities = 46/53 (86%), Positives = 48/53 (90%), Gaps = 1/53 (1%) Frame = +1 Query: 58 TWEELEREASNADREKGNESDSEDDRKRRKAKAFGNSR-ASLSSSMPKRRKLR 213 TWEELEREASNADREKGNESDSE+DRKRRKAK+FG SR A LSSSM KR KLR Sbjct: 1017 TWEELEREASNADREKGNESDSEEDRKRRKAKSFGKSRGAGLSSSMTKRPKLR 1069 >ref|XP_003618435.1| FACT complex subunit SPT16 [Medicago truncatula] gi|355493450|gb|AES74653.1| FACT complex subunit SPT16 [Medicago truncatula] Length = 1058 Score = 88.6 bits (218), Expect = 1e-15 Identities = 45/53 (84%), Positives = 48/53 (90%), Gaps = 1/53 (1%) Frame = +1 Query: 58 TWEELEREASNADREKGNESDSEDDRKRRKAK-AFGNSRASLSSSMPKRRKLR 213 TWEELER+ASNADREKGNESDSE+DRKRRKAK AFG R +LSSSMPKR KLR Sbjct: 1006 TWEELERDASNADREKGNESDSEEDRKRRKAKAAFGKPRGNLSSSMPKRPKLR 1058