BLASTX nr result
ID: Glycyrrhiza23_contig00005046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00005046 (419 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003531072.1| PREDICTED: reticuline oxidase-like protein-l... 81 1e-24 ref|XP_003524781.1| PREDICTED: reticuline oxidase-like protein-l... 81 1e-24 ref|XP_003532643.1| PREDICTED: reticuline oxidase-like protein-l... 69 8e-13 ref|XP_002523164.1| Reticuline oxidase precursor, putative [Rici... 72 2e-12 ref|XP_002332870.1| predicted protein [Populus trichocarpa] gi|2... 68 2e-12 >ref|XP_003531072.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max] Length = 533 Score = 80.9 bits (198), Expect(2) = 1e-24 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +3 Query: 294 TSILNSTAQNLRYLLPSVPKPDFIFTPLHDSQVQAAVICAKK 419 TSIL STAQNLRYLLPSVPKPDFIFTPL DSQVQAAV+CAKK Sbjct: 56 TSILESTAQNLRYLLPSVPKPDFIFTPLDDSQVQAAVVCAKK 97 Score = 57.4 bits (137), Expect(2) = 1e-24 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +1 Query: 130 PIEETFNHCLTLHSQTPNQFPSTIYTSRNDS 222 PIEE FNHCLT HSQTPNQFPS+IYT N S Sbjct: 24 PIEEAFNHCLTQHSQTPNQFPSSIYTYTNGS 54 >ref|XP_003524781.1| PREDICTED: reticuline oxidase-like protein-like [Glycine max] Length = 534 Score = 81.3 bits (199), Expect(2) = 1e-24 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +3 Query: 294 TSILNSTAQNLRYLLPSVPKPDFIFTPLHDSQVQAAVICAKK 419 TSIL STAQNLRYLLPSVPKPDFIFTPL DSQVQAAVICAKK Sbjct: 57 TSILESTAQNLRYLLPSVPKPDFIFTPLDDSQVQAAVICAKK 98 Score = 56.6 bits (135), Expect(2) = 1e-24 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = +1 Query: 130 PIEETFNHCLTLHSQTPNQFPSTIYTSRNDS 222 PIEE FNHCLT HSQTPNQF S+IYTS N S Sbjct: 25 PIEEAFNHCLTQHSQTPNQFSSSIYTSTNGS 55 >ref|XP_003532643.1| PREDICTED: reticuline oxidase-like protein-like, partial [Glycine max] Length = 532 Score = 69.3 bits (168), Expect(2) = 8e-13 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +3 Query: 294 TSILNSTAQNLRYLLPSVPKPDFIFTPLHDSQVQAAVICAKK 419 TSIL+S+AQNLR L+PSVPKP+FIFTP DS VQAAVIC+KK Sbjct: 58 TSILDSSAQNLRLLVPSVPKPEFIFTPSRDSHVQAAVICSKK 99 Score = 28.9 bits (63), Expect(2) = 8e-13 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 133 IEETFNHCLTLHSQTPNQFPSTIYTSRNDS 222 ++E+F CL L+S F S+IYT+ N S Sbjct: 27 VQESFVQCLNLNSDKTFPFYSSIYTASNPS 56 >ref|XP_002523164.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223537571|gb|EEF39195.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 548 Score = 72.4 bits (176), Expect(2) = 2e-12 Identities = 32/42 (76%), Positives = 40/42 (95%) Frame = +3 Query: 294 TSILNSTAQNLRYLLPSVPKPDFIFTPLHDSQVQAAVICAKK 419 +S+L S+AQNLRYLLPSVPKP+FIFTPLH++ VQAAVIC+K+ Sbjct: 60 SSVLQSSAQNLRYLLPSVPKPEFIFTPLHETHVQAAVICSKQ 101 Score = 24.6 bits (52), Expect(2) = 2e-12 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +1 Query: 130 PIEETFNHCLTLHSQTPNQFPSTIYTSRNDS 222 PI ++F CL ++S+ F ++ YT N S Sbjct: 28 PIFDSFIQCLKVNSEILIPFSTSFYTHDNSS 58 >ref|XP_002332870.1| predicted protein [Populus trichocarpa] gi|222834675|gb|EEE73138.1| predicted protein [Populus trichocarpa] Length = 532 Score = 68.2 bits (165), Expect(2) = 2e-12 Identities = 29/42 (69%), Positives = 38/42 (90%) Frame = +3 Query: 294 TSILNSTAQNLRYLLPSVPKPDFIFTPLHDSQVQAAVICAKK 419 T++L STAQNLRY+LPSVPKP+FIFTP ++S +QAAV+C K+ Sbjct: 58 TTVLLSTAQNLRYILPSVPKPEFIFTPFNESDIQAAVVCCKQ 99 Score = 28.9 bits (63), Expect(2) = 2e-12 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +1 Query: 130 PIEETFNHCLTLHSQTPNQFPSTIYTSRNDS 222 PI++TF CL+ S++ F + +YT N+S Sbjct: 25 PIQDTFLQCLSTTSESSFPFSTALYTPINNS 55