BLASTX nr result
ID: Glycyrrhiza23_contig00003683
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00003683 (470 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR13282.1| putative S-adenosylmethionine decarboxylase [Prun... 71 1e-10 gb|AAN03493.1|AF291761_1 uORF [Ipomoea batatas] 70 2e-10 gb|AAW56945.1| putative SAMDC uORF [Phaseolus vulgaris] 69 3e-10 ref|XP_003631339.1| PREDICTED: S-adenosylmethionine decarboxylas... 69 3e-10 gb|AAB03864.1| putative ORF; conserved in 5' leaders of plant SA... 69 3e-10 >gb|ABR13282.1| putative S-adenosylmethionine decarboxylase [Prunus dulcis] Length = 56 Score = 70.9 bits (172), Expect = 1e-10 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -3 Query: 264 LNDLMEXXXXXXXXXXXXSVFYEAPLGYTIEDIRPNGGIKKFRSAAYSNLSRKP 103 LN+LME S+FYEAPLGY+IED+RP+GGIKKFRSAAYSN RKP Sbjct: 2 LNELMESKGGKKKSSSSKSLFYEAPLGYSIEDVRPHGGIKKFRSAAYSNCVRKP 55 >gb|AAN03493.1|AF291761_1 uORF [Ipomoea batatas] Length = 51 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -3 Query: 207 VFYEAPLGYTIEDIRPNGGIKKFRSAAYSNLSRKP 103 +FYEAPLGYT+ED+RPNGGIKKFRSAAYSN +RKP Sbjct: 16 LFYEAPLGYTVEDVRPNGGIKKFRSAAYSNCARKP 50 >gb|AAW56945.1| putative SAMDC uORF [Phaseolus vulgaris] Length = 53 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -3 Query: 207 VFYEAPLGYTIEDIRPNGGIKKFRSAAYSNLSRKP 103 +FYEAPLGY+IEDIRPNGGIKKFRSAAYSN +RKP Sbjct: 18 LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKP 52 >ref|XP_003631339.1| PREDICTED: S-adenosylmethionine decarboxylase proenzyme [Vitis vinifera] Length = 410 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -3 Query: 207 VFYEAPLGYTIEDIRPNGGIKKFRSAAYSNLSRKP 103 +FYEAPLGY+IEDIRPNGGIKKFRSAAYSN +RKP Sbjct: 15 LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKP 49 >gb|AAB03864.1| putative ORF; conserved in 5' leaders of plant SAMdC [Pisum sativum] Length = 54 Score = 69.3 bits (168), Expect = 3e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -3 Query: 207 VFYEAPLGYTIEDIRPNGGIKKFRSAAYSNLSRKP 103 +FYEAPLGY+IEDIRPNGGIKKFRSAAYSN +RKP Sbjct: 19 LFYEAPLGYSIEDIRPNGGIKKFRSAAYSNCARKP 53