BLASTX nr result
ID: Glycyrrhiza23_contig00003642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00003642 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001239854.1| uncharacterized protein LOC100818986 [Glycin... 107 8e-22 ref|NP_001235523.1| uncharacterized protein LOC100499751 [Glycin... 107 8e-22 emb|CBI18930.3| unnamed protein product [Vitis vinifera] 103 1e-20 ref|XP_004136371.1| PREDICTED: ribonuclease P protein subunit p2... 103 1e-20 gb|AFK39416.1| unknown [Lotus japonicus] 103 1e-20 >ref|NP_001239854.1| uncharacterized protein LOC100818986 [Glycine max] gi|255639553|gb|ACU20071.1| unknown [Glycine max] Length = 249 Score = 107 bits (268), Expect = 8e-22 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = +2 Query: 107 MDRYQKVEKPRAETPIDENEIRITSQGRMRNYITYAMSLLQEKGSNEIVFKAM 265 MDRYQKVEKPRAETPIDENEIRITSQGRMRNYITYAMSLLQEKGSNEIVFKAM Sbjct: 1 MDRYQKVEKPRAETPIDENEIRITSQGRMRNYITYAMSLLQEKGSNEIVFKAM 53 >ref|NP_001235523.1| uncharacterized protein LOC100499751 [Glycine max] gi|255626263|gb|ACU13476.1| unknown [Glycine max] Length = 98 Score = 107 bits (268), Expect = 8e-22 Identities = 53/53 (100%), Positives = 53/53 (100%) Frame = +2 Query: 107 MDRYQKVEKPRAETPIDENEIRITSQGRMRNYITYAMSLLQEKGSNEIVFKAM 265 MDRYQKVEKPRAETPIDENEIRITSQGRMRNYITYAMSLLQEKGSNEIVFKAM Sbjct: 1 MDRYQKVEKPRAETPIDENEIRITSQGRMRNYITYAMSLLQEKGSNEIVFKAM 53 >emb|CBI18930.3| unnamed protein product [Vitis vinifera] Length = 514 Score = 103 bits (258), Expect = 1e-20 Identities = 59/81 (72%), Positives = 64/81 (79%), Gaps = 5/81 (6%) Frame = +2 Query: 38 QSRRRGLALFFVFVKETLSL-----GIAMDRYQKVEKPRAETPIDENEIRITSQGRMRNY 202 +S+RRGL F+ LSL MDRYQ+VEKPR ETPIDENEIRITSQGRMR+Y Sbjct: 233 RSQRRGL---FLRGASILSLQKNIQSEKMDRYQRVEKPREETPIDENEIRITSQGRMRSY 289 Query: 203 ITYAMSLLQEKGSNEIVFKAM 265 ITYAMSLLQEKGSNEIVFKAM Sbjct: 290 ITYAMSLLQEKGSNEIVFKAM 310 >ref|XP_004136371.1| PREDICTED: ribonuclease P protein subunit p25-like protein-like [Cucumis sativus] gi|449511234|ref|XP_004163900.1| PREDICTED: ribonuclease P protein subunit p25-like protein-like [Cucumis sativus] Length = 264 Score = 103 bits (257), Expect = 1e-20 Identities = 50/53 (94%), Positives = 52/53 (98%) Frame = +2 Query: 107 MDRYQKVEKPRAETPIDENEIRITSQGRMRNYITYAMSLLQEKGSNEIVFKAM 265 MDRY +VEKPRAETPIDENEIRITSQGRMRNYITYAM+LLQEKGSNEIVFKAM Sbjct: 1 MDRYHRVEKPRAETPIDENEIRITSQGRMRNYITYAMTLLQEKGSNEIVFKAM 53 >gb|AFK39416.1| unknown [Lotus japonicus] Length = 250 Score = 103 bits (257), Expect = 1e-20 Identities = 51/53 (96%), Positives = 52/53 (98%) Frame = +2 Query: 107 MDRYQKVEKPRAETPIDENEIRITSQGRMRNYITYAMSLLQEKGSNEIVFKAM 265 MDRYQKVEKPRAET IDENEIRITSQGRMRNYITYAM+LLQEKGSNEIVFKAM Sbjct: 1 MDRYQKVEKPRAETSIDENEIRITSQGRMRNYITYAMTLLQEKGSNEIVFKAM 53