BLASTX nr result
ID: Glycyrrhiza23_contig00003495
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00003495 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588355.1| Mitochondrial protein, putative [Medicago tr... 102 4e-20 emb|CAJ30048.1| hypothetical protein mgI390 [Magnetospirillum gr... 51 6e-07 ref|YP_005415552.1| hypothetical protein RSPPHO_03243, partial [... 49 2e-06 >ref|XP_003588355.1| Mitochondrial protein, putative [Medicago truncatula] gi|355477403|gb|AES58606.1| Mitochondrial protein, putative [Medicago truncatula] Length = 1106 Score = 102 bits (253), Expect = 4e-20 Identities = 57/92 (61%), Positives = 57/92 (61%) Frame = +2 Query: 5 FRLVRDRFTPRGAYTSRLSKFCSKTSSENLYREGFPAAQQFFHTNLAARRCYWHNNRYTI 184 FRLVRDRFTPRGAYTSRLSKFCSKTS ENLYREGFP Sbjct: 359 FRLVRDRFTPRGAYTSRLSKFCSKTSFENLYREGFP------------------------ 394 Query: 185 GWPNPVLSY*GWLLAVLPLTPTVDRNRTVSRR 280 GWLLAVLPLTPTVDRNRTVSRR Sbjct: 395 ----------GWLLAVLPLTPTVDRNRTVSRR 416 >emb|CAJ30048.1| hypothetical protein mgI390 [Magnetospirillum gryphiswaldense MSR-1] Length = 76 Score = 50.8 bits (120), Expect(2) = 6e-07 Identities = 21/30 (70%), Positives = 22/30 (73%) Frame = -2 Query: 236 GELRGANPSTRGLGWANLWCTGCYANSSAG 147 G LRG PSTRG GW LWCTGC+AN AG Sbjct: 47 GNLRGPVPSTRGPGWTYLWCTGCHANGIAG 76 Score = 27.3 bits (59), Expect(2) = 6e-07 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 282 ERRETVRFLSTVGV 241 ERRETVR LSTVGV Sbjct: 33 ERRETVRSLSTVGV 46 >ref|YP_005415552.1| hypothetical protein RSPPHO_03243, partial [Rhodospirillum photometricum DSM 122] gi|384260384|ref|YP_005415570.1| hypothetical protein RSPPHO_03261, partial [Rhodospirillum photometricum DSM 122] gi|378401466|emb|CCG06582.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum DSM 122] gi|378401484|emb|CCG06600.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum DSM 122] Length = 109 Score = 49.3 bits (116), Expect(2) = 2e-06 Identities = 20/30 (66%), Positives = 22/30 (73%) Frame = -2 Query: 236 GELRGANPSTRGLGWANLWCTGCYANSSAG 147 G LRGA PSTRG GW +LWCT C+A AG Sbjct: 80 GNLRGAVPSTRGPGWTSLWCTSCHARGIAG 109 Score = 27.3 bits (59), Expect(2) = 2e-06 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 282 ERRETVRFLSTVGV 241 ERRETVR LSTVGV Sbjct: 66 ERRETVRSLSTVGV 79