BLASTX nr result
ID: Glycyrrhiza23_contig00003357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00003357 (762 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK37176.1| unknown [Medicago truncatula] 90 5e-16 emb|CAC69854.1| putative thioredoxin m2 [Pisum sativum] 84 3e-14 ref|XP_003541848.1| PREDICTED: thioredoxin M4, chloroplastic-lik... 77 4e-12 ref|XP_003540097.1| PREDICTED: thioredoxin M4, chloroplastic-lik... 76 7e-12 ref|XP_003527258.1| PREDICTED: thioredoxin M4, chloroplastic-lik... 73 6e-11 >gb|AFK37176.1| unknown [Medicago truncatula] Length = 173 Score = 90.1 bits (222), Expect = 5e-16 Identities = 43/58 (74%), Positives = 49/58 (84%) Frame = +3 Query: 297 PHYTGLKLRPLAATRSLSHTASRIVPRGGGVVCEARDSTAVEVASITDANWQSLVLES 470 P YTGLKLRP++ATR S + R+ PRGG VVCEARD+TAVEVASITD NWQSLV+ES Sbjct: 28 PPYTGLKLRPVSATRLRSQSTGRVFPRGGTVVCEARDTTAVEVASITDGNWQSLVIES 85 >emb|CAC69854.1| putative thioredoxin m2 [Pisum sativum] Length = 180 Score = 84.0 bits (206), Expect = 3e-14 Identities = 46/59 (77%), Positives = 49/59 (83%), Gaps = 1/59 (1%) Frame = +3 Query: 297 PHYTGLKLRPLAATRSLSH-TASRIVPRGGGVVCEARDSTAVEVASITDANWQSLVLES 470 P YTGLKLRPLAAT S ASR+VPRGG V+CEARD TAVEVASITD NWQSLV+ES Sbjct: 35 PPYTGLKLRPLAATSLRSRFAASRVVPRGGRVLCEARD-TAVEVASITDGNWQSLVIES 92 >ref|XP_003541848.1| PREDICTED: thioredoxin M4, chloroplastic-like [Glycine max] Length = 233 Score = 77.0 bits (188), Expect = 4e-12 Identities = 39/59 (66%), Positives = 45/59 (76%) Frame = +3 Query: 294 LPHYTGLKLRPLAATRSLSHTASRIVPRGGGVVCEARDSTAVEVASITDANWQSLVLES 470 LP Y+GL+LRP A T +H +SR RGGGV CEA D TAVEVA +TDANWQSLV+ES Sbjct: 88 LPRYSGLRLRPAAETSFPTHASSRTASRGGGVKCEAGD-TAVEVAPVTDANWQSLVIES 145 >ref|XP_003540097.1| PREDICTED: thioredoxin M4, chloroplastic-like [Glycine max] Length = 175 Score = 76.3 bits (186), Expect = 7e-12 Identities = 41/59 (69%), Positives = 45/59 (76%) Frame = +3 Query: 294 LPHYTGLKLRPLAATRSLSHTASRIVPRGGGVVCEARDSTAVEVASITDANWQSLVLES 470 LPH GL+LRP AATR ++ A RI R VVCEA+D TAVEVA ITDANWQSLVLES Sbjct: 30 LPHCAGLRLRPAAATRLVASPARRIASRAARVVCEAQD-TAVEVAPITDANWQSLVLES 87 >ref|XP_003527258.1| PREDICTED: thioredoxin M4, chloroplastic-like [Glycine max] Length = 169 Score = 73.2 bits (178), Expect = 6e-11 Identities = 39/59 (66%), Positives = 44/59 (74%) Frame = +3 Query: 294 LPHYTGLKLRPLAATRSLSHTASRIVPRGGGVVCEARDSTAVEVASITDANWQSLVLES 470 LPH GL+LRP AA+R ++ A RI R V CEA+D TAVEVA ITDANWQSLVLES Sbjct: 24 LPHCAGLRLRPAAASRLVASPARRIASRAARVACEAQD-TAVEVAPITDANWQSLVLES 81