BLASTX nr result
ID: Glycyrrhiza23_contig00003054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00003054 (387 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003622373.1| Eukaryotic translation initiation factor [Me... 57 2e-06 >ref|XP_003622373.1| Eukaryotic translation initiation factor [Medicago truncatula] gi|355497388|gb|AES78591.1| Eukaryotic translation initiation factor [Medicago truncatula] Length = 489 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/41 (70%), Positives = 32/41 (78%), Gaps = 2/41 (4%) Frame = -3 Query: 118 VFYRYPILQLVLWVKDFC--HLSVMATRLQFENSCEVGVFS 2 VF P ++LV W+K FC LSVMATRLQFENSCEVGVFS Sbjct: 221 VFKLRPNIKLVSWIKHFCLSSLSVMATRLQFENSCEVGVFS 261