BLASTX nr result
ID: Glycyrrhiza23_contig00002403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00002403 (444 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABI84265.1| ubiquitin/ribosomal protein S27a [Arachis hypogaea] 121 7e-26 ref|XP_003613203.1| Ubiquitin [Medicago truncatula] gi|355514538... 120 1e-25 gb|ACJ83917.1| unknown [Medicago truncatula] gi|217075699|gb|ACJ... 120 1e-25 ref|XP_002270170.1| PREDICTED: ubiquitin-40S ribosomal protein S... 120 1e-25 ref|XP_003629895.1| Ubiquitin [Medicago truncatula] gi|355523917... 120 1e-25 >gb|ABI84265.1| ubiquitin/ribosomal protein S27a [Arachis hypogaea] Length = 155 Score = 121 bits (303), Expect = 7e-26 Identities = 53/55 (96%), Positives = 55/55 (100%) Frame = +1 Query: 34 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAA 198 LA+LQFYK+DDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAA Sbjct: 100 LAILQFYKIDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKAA 154 >ref|XP_003613203.1| Ubiquitin [Medicago truncatula] gi|355514538|gb|AES96161.1| Ubiquitin [Medicago truncatula] Length = 155 Score = 120 bits (301), Expect = 1e-25 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = +1 Query: 34 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 195 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >gb|ACJ83917.1| unknown [Medicago truncatula] gi|217075699|gb|ACJ86209.1| unknown [Medicago truncatula] Length = 155 Score = 120 bits (301), Expect = 1e-25 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = +1 Query: 34 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 195 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >ref|XP_002270170.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 1 [Vitis vinifera] gi|359481049|ref|XP_003632559.1| PREDICTED: ubiquitin-40S ribosomal protein S27a isoform 2 [Vitis vinifera] Length = 156 Score = 120 bits (301), Expect = 1e-25 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = +1 Query: 34 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 195 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA Sbjct: 100 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >ref|XP_003629895.1| Ubiquitin [Medicago truncatula] gi|355523917|gb|AET04371.1| Ubiquitin [Medicago truncatula] Length = 232 Score = 120 bits (301), Expect = 1e-25 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = +1 Query: 34 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 195 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA Sbjct: 177 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 230