BLASTX nr result
ID: Glycyrrhiza23_contig00002287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00002287 (344 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002331062.1| vacuolar H+-translocating inorganic pyrophos... 134 8e-30 gb|ABK94904.1| unknown [Populus trichocarpa] 134 8e-30 ref|XP_003609463.1| Vacuolar proton-inorganic pyrophosphatase [M... 134 8e-30 gb|ABR18024.1| unknown [Picea sitchensis] 133 1e-29 emb|CAA58701.1| inorganic pyrophosphatase [Nicotiana tabacum] 133 2e-29 >ref|XP_002331062.1| vacuolar H+-translocating inorganic pyrophosphatase [Populus trichocarpa] gi|222872992|gb|EEF10123.1| vacuolar H+-translocating inorganic pyrophosphatase [Populus trichocarpa] Length = 768 Score = 134 bits (337), Expect = 8e-30 Identities = 66/66 (100%), Positives = 66/66 (100%) Frame = -3 Query: 342 GASEHARSLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHG 163 GASEHARSLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHG Sbjct: 702 GASEHARSLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHG 761 Query: 162 GLLFKI 145 GLLFKI Sbjct: 762 GLLFKI 767 >gb|ABK94904.1| unknown [Populus trichocarpa] Length = 288 Score = 134 bits (337), Expect = 8e-30 Identities = 66/66 (100%), Positives = 66/66 (100%) Frame = -3 Query: 342 GASEHARSLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHG 163 GASEHARSLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHG Sbjct: 222 GASEHARSLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHG 281 Query: 162 GLLFKI 145 GLLFKI Sbjct: 282 GLLFKI 287 >ref|XP_003609463.1| Vacuolar proton-inorganic pyrophosphatase [Medicago truncatula] gi|206748391|gb|ACI22377.1| vacuolar-type H-pyrophosphatase [Medicago truncatula] gi|355510518|gb|AES91660.1| Vacuolar proton-inorganic pyrophosphatase [Medicago truncatula] Length = 765 Score = 134 bits (337), Expect = 8e-30 Identities = 66/66 (100%), Positives = 66/66 (100%) Frame = -3 Query: 342 GASEHARSLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHG 163 GASEHARSLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHG Sbjct: 700 GASEHARSLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHG 759 Query: 162 GLLFKI 145 GLLFKI Sbjct: 760 GLLFKI 765 >gb|ABR18024.1| unknown [Picea sitchensis] Length = 765 Score = 133 bits (335), Expect = 1e-29 Identities = 65/66 (98%), Positives = 66/66 (100%) Frame = -3 Query: 342 GASEHARSLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHG 163 GASEHARSLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHG Sbjct: 700 GASEHARSLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHG 759 Query: 162 GLLFKI 145 GLLFK+ Sbjct: 760 GLLFKL 765 >emb|CAA58701.1| inorganic pyrophosphatase [Nicotiana tabacum] Length = 765 Score = 133 bits (334), Expect = 2e-29 Identities = 65/66 (98%), Positives = 66/66 (100%) Frame = -3 Query: 342 GASEHARSLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHG 163 GASEHAR+LGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHG Sbjct: 699 GASEHARTLGPKGSDPHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPFFATHG 758 Query: 162 GLLFKI 145 GLLFKI Sbjct: 759 GLLFKI 764