BLASTX nr result
ID: Glycyrrhiza23_contig00001173
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza23_contig00001173 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK41855.1| unknown [Medicago truncatula] 77 2e-12 ref|XP_003615390.1| Auxin-responsive protein IAA5 [Medicago trun... 77 2e-12 gb|ADN34477.1| auxin influx carrier [Arachis hypogaea] 76 3e-12 ref|XP_003612933.1| Auxin-responsive protein (Aux/IAA) [Medicago... 75 7e-12 gb|ABY48132.1| GH1 protein [Medicago truncatula] 75 7e-12 >gb|AFK41855.1| unknown [Medicago truncatula] Length = 111 Score = 76.6 bits (187), Expect = 2e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +3 Query: 3 DVPWEMFIDTCRRLRIMKGSDAIGLAPRAVEKSKSRN 113 DVPWEMFIDTCRRLRIMK SDAIGLAPRAVEKSKSRN Sbjct: 75 DVPWEMFIDTCRRLRIMKSSDAIGLAPRAVEKSKSRN 111 >ref|XP_003615390.1| Auxin-responsive protein IAA5 [Medicago truncatula] gi|355516725|gb|AES98348.1| Auxin-responsive protein IAA5 [Medicago truncatula] Length = 347 Score = 76.6 bits (187), Expect = 2e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +3 Query: 3 DVPWEMFIDTCRRLRIMKGSDAIGLAPRAVEKSKSRN 113 DVPWEMFIDTCRRLRIMK SDAIGLAPRAVEKSKSRN Sbjct: 311 DVPWEMFIDTCRRLRIMKSSDAIGLAPRAVEKSKSRN 347 >gb|ADN34477.1| auxin influx carrier [Arachis hypogaea] Length = 96 Score = 76.3 bits (186), Expect = 3e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +3 Query: 3 DVPWEMFIDTCRRLRIMKGSDAIGLAPRAVEKSKSRN 113 DVPWEMFI+TCRRLRIMKG+DAIGLAPRAVEKSKSRN Sbjct: 60 DVPWEMFIETCRRLRIMKGADAIGLAPRAVEKSKSRN 96 >ref|XP_003612933.1| Auxin-responsive protein (Aux/IAA) [Medicago truncatula] gi|355514268|gb|AES95891.1| Auxin-responsive protein (Aux/IAA) [Medicago truncatula] Length = 335 Score = 74.7 bits (182), Expect = 7e-12 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 3 DVPWEMFIDTCRRLRIMKGSDAIGLAPRAVEKSKSRN 113 DVPWEMFIDTCRRL+IMKGSDAIGLAPRA+EKSKSR+ Sbjct: 299 DVPWEMFIDTCRRLKIMKGSDAIGLAPRAMEKSKSRS 335 >gb|ABY48132.1| GH1 protein [Medicago truncatula] Length = 335 Score = 74.7 bits (182), Expect = 7e-12 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 3 DVPWEMFIDTCRRLRIMKGSDAIGLAPRAVEKSKSRN 113 DVPWEMFIDTCRRL+IMKGSDAIGLAPRA+EKSKSR+ Sbjct: 299 DVPWEMFIDTCRRLKIMKGSDAIGLAPRAMEKSKSRS 335