BLASTX nr result
ID: Gardenia21_contig00050458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00050458 (309 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535142.1| conserved hypothetical protein [Ricinus comm... 72 8e-17 ref|XP_013442474.1| hypothetical protein MTR_0165s0050 [Medicago... 49 1e-07 ref|XP_010095217.1| hypothetical protein L484_003934 [Morus nota... 43 1e-06 >ref|XP_002535142.1| conserved hypothetical protein [Ricinus communis] gi|223523947|gb|EEF27248.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 72.0 bits (175), Expect(2) = 8e-17 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +1 Query: 85 AVIYLDQFPEALEIQTGSENHWPFWRPSFRQQRSHP 192 AVIYLDQFPEALEIQTGSENHW RPSFRQQRSHP Sbjct: 31 AVIYLDQFPEALEIQTGSENHWRLRRPSFRQQRSHP 66 Score = 41.6 bits (96), Expect(2) = 8e-17 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = +3 Query: 12 YFRAGREVKAIREDCPPGKEE 74 YF REVKAIREDCPPGKEE Sbjct: 9 YFLTEREVKAIREDCPPGKEE 29 >ref|XP_013442474.1| hypothetical protein MTR_0165s0050 [Medicago truncatula] gi|657370355|gb|KEH16499.1| hypothetical protein MTR_0165s0050 [Medicago truncatula] Length = 108 Score = 48.9 bits (115), Expect(2) = 1e-07 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = +3 Query: 12 YFRAGREVKAIREDCPPGKEE 74 YFRAGREVKAIREDCPPGKEE Sbjct: 15 YFRAGREVKAIREDCPPGKEE 35 Score = 33.9 bits (76), Expect(2) = 1e-07 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +1 Query: 70 KRGKGAVIYLDQFPEALEIQ 129 +R +GAVIYLDQFPEAL+I+ Sbjct: 35 ERCQGAVIYLDQFPEALKIK 54 >ref|XP_010095217.1| hypothetical protein L484_003934 [Morus notabilis] gi|587869360|gb|EXB58678.1| hypothetical protein L484_003934 [Morus notabilis] Length = 78 Score = 43.1 bits (100), Expect(2) = 1e-06 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = +1 Query: 97 LDQFPEALEIQTGSENHW 150 LDQFPEALEIQTGSENHW Sbjct: 42 LDQFPEALEIQTGSENHW 59 Score = 36.2 bits (82), Expect(2) = 1e-06 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 164 LRFANKEVILDDFPFL 211 LRFANKEVILDDFPFL Sbjct: 62 LRFANKEVILDDFPFL 77