BLASTX nr result
ID: Gardenia21_contig00050164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00050164 (222 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP21098.1| unnamed protein product [Coffea canephora] 72 2e-10 emb|CDP21232.1| unnamed protein product [Coffea canephora] 65 2e-08 emb|CDP09602.1| unnamed protein product [Coffea canephora] 64 3e-08 emb|CDP19872.1| unnamed protein product [Coffea canephora] 64 3e-08 emb|CDP21959.1| unnamed protein product [Coffea canephora] 64 3e-08 emb|CDP21896.1| unnamed protein product, partial [Coffea canephora] 62 1e-07 >emb|CDP21098.1| unnamed protein product [Coffea canephora] Length = 998 Score = 71.6 bits (174), Expect = 2e-10 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = +1 Query: 94 KEGMGLLKGVQELVFSRIERSYNHLQTAEAKYLLLPCSLFPED 222 K+ MG LKGVQ+LVFSRIE SYNHL+TAEAK+LLL CSLFPED Sbjct: 382 KDRMGNLKGVQDLVFSRIEWSYNHLETAEAKHLLLLCSLFPED 424 >emb|CDP21232.1| unnamed protein product [Coffea canephora] Length = 975 Score = 65.1 bits (157), Expect = 2e-08 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +1 Query: 94 KEGMGLLKGVQELVFSRIERSYNHLQTAEAKYLLLPCSLFPED 222 K+ MG L+GVQ+LVF RIE SYNHL T EAK+LLL CSLFPED Sbjct: 396 KDRMGNLRGVQDLVFLRIEWSYNHLGTTEAKHLLLLCSLFPED 438 >emb|CDP09602.1| unnamed protein product [Coffea canephora] Length = 682 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +1 Query: 94 KEGMGLLKGVQELVFSRIERSYNHLQTAEAKYLLLPCSLFPED 222 K+ MG L+GVQ+LVF RIE SYNHL T EAK+LLL CSLFPED Sbjct: 207 KDRMGNLRGVQDLVFLRIEWSYNHLGTDEAKHLLLLCSLFPED 249 >emb|CDP19872.1| unnamed protein product [Coffea canephora] Length = 963 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +1 Query: 94 KEGMGLLKGVQELVFSRIERSYNHLQTAEAKYLLLPCSLFPED 222 K+ MG LK VQ+L+FSRIE SYN L+TAE KYLLL CSLFPED Sbjct: 403 KDRMGNLKEVQDLLFSRIEWSYNRLETAEMKYLLLLCSLFPED 445 >emb|CDP21959.1| unnamed protein product [Coffea canephora] Length = 763 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +1 Query: 94 KEGMGLLKGVQELVFSRIERSYNHLQTAEAKYLLLPCSLFPED 222 K+ MG L+GVQ+LVF RIE SYNHL T EAK+LLL CSLFPED Sbjct: 155 KDRMGNLRGVQDLVFLRIEWSYNHLGTDEAKHLLLLCSLFPED 197 >emb|CDP21896.1| unnamed protein product, partial [Coffea canephora] Length = 931 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +1 Query: 103 MGLLKGVQELVFSRIERSYNHLQTAEAKYLLLPCSLFPED 222 MG L+GVQ+LVF RIE SYNHL T EAK+LLL CSLFPED Sbjct: 378 MGNLRGVQDLVFLRIEWSYNHLGTDEAKHLLLLCSLFPED 417