BLASTX nr result
ID: Gardenia21_contig00049395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00049395 (275 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14517.1| unnamed protein product [Coffea canephora] 109 9e-22 ref|XP_010242846.1| PREDICTED: NAC transcription factor 29-like ... 65 2e-08 ref|XP_012449436.1| PREDICTED: protein FEZ-like [Gossypium raimo... 57 5e-06 gb|KJB47738.1| hypothetical protein B456_008G038800 [Gossypium r... 56 9e-06 gb|KJB47737.1| hypothetical protein B456_008G038800 [Gossypium r... 56 9e-06 ref|XP_012436419.1| PREDICTED: putative NAC domain-containing pr... 56 9e-06 gb|KHF98147.1| Putative NAC domain-containing 94 -like protein [... 56 9e-06 gb|AHY02159.1| NAC domain protein 78 [Gossypium hirsutum] 56 9e-06 gb|AGC27319.1| NAC domain protein 16 [Gossypium hirsutum] 56 9e-06 gb|AGC97441.1| NAC protein 11 [Gossypium hirsutum] 56 9e-06 >emb|CDP14517.1| unnamed protein product [Coffea canephora] Length = 310 Score = 109 bits (272), Expect = 9e-22 Identities = 61/76 (80%), Positives = 64/76 (84%), Gaps = 3/76 (3%) Frame = -2 Query: 229 SLECKGKSRTRTNDLRLPAAAATTGGKSVNEKLAELQVPSRLSMDWTQDPFWAQLRSPWL 50 SLECKGKSRT TN+LRLP+ TT GKS N KLAELQVPSRLSMDWTQDPFWAQLRSPWL Sbjct: 239 SLECKGKSRTCTNNLRLPST--TTTGKSGN-KLAELQVPSRLSMDWTQDPFWAQLRSPWL 295 Query: 49 D---TPNSYANNVLNF 11 D TPN +A NVLNF Sbjct: 296 DNLATPNYHA-NVLNF 310 >ref|XP_010242846.1| PREDICTED: NAC transcription factor 29-like [Nelumbo nucifera] Length = 308 Score = 65.5 bits (158), Expect = 2e-08 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = -2 Query: 154 GKSVNEKLAELQVPSRLSMDWTQDPFWAQLRSPWLDTPNSYANNVLNF 11 G + +KL ELQ+P +L+MDWTQDPFW QLRSPWLD YA N+LNF Sbjct: 263 GLKLKKKLPELQLP-KLTMDWTQDPFWTQLRSPWLDNWTPYA-NILNF 308 >ref|XP_012449436.1| PREDICTED: protein FEZ-like [Gossypium raimondii] gi|823129628|ref|XP_012449442.1| PREDICTED: protein FEZ-like [Gossypium raimondii] gi|586637259|gb|AHJ79198.1| NAC domain protein NAC57 [Gossypium hirsutum] gi|763744690|gb|KJB12129.1| hypothetical protein B456_002G001900 [Gossypium raimondii] Length = 279 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/44 (54%), Positives = 29/44 (65%) Frame = -2 Query: 142 NEKLAELQVPSRLSMDWTQDPFWAQLRSPWLDTPNSYANNVLNF 11 NE + +LQ+P L+ DWTQD FWAQL SPW Y N+LNF Sbjct: 237 NENMGQLQIPKMLT-DWTQDQFWAQLNSPWFQNLTPYVANILNF 279 >gb|KJB47738.1| hypothetical protein B456_008G038800 [Gossypium raimondii] Length = 244 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -2 Query: 142 NEKLAELQVPSRLSMDWTQDPFWAQLRSPWLDTPNSYANNVLNF 11 NEKLAELQ+P ++ DWTQD FW QL SPW YA N+LNF Sbjct: 203 NEKLAELQLPKIIN-DWTQDQFWTQLNSPWFQNLTPYA-NILNF 244 >gb|KJB47737.1| hypothetical protein B456_008G038800 [Gossypium raimondii] Length = 286 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -2 Query: 142 NEKLAELQVPSRLSMDWTQDPFWAQLRSPWLDTPNSYANNVLNF 11 NEKLAELQ+P ++ DWTQD FW QL SPW YA N+LNF Sbjct: 245 NEKLAELQLPKIIN-DWTQDQFWTQLNSPWFQNLTPYA-NILNF 286 >ref|XP_012436419.1| PREDICTED: putative NAC domain-containing protein 94 [Gossypium raimondii] gi|763780665|gb|KJB47736.1| hypothetical protein B456_008G038800 [Gossypium raimondii] Length = 292 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -2 Query: 142 NEKLAELQVPSRLSMDWTQDPFWAQLRSPWLDTPNSYANNVLNF 11 NEKLAELQ+P ++ DWTQD FW QL SPW YA N+LNF Sbjct: 251 NEKLAELQLPKIIN-DWTQDQFWTQLNSPWFQNLTPYA-NILNF 292 >gb|KHF98147.1| Putative NAC domain-containing 94 -like protein [Gossypium arboreum] Length = 291 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -2 Query: 142 NEKLAELQVPSRLSMDWTQDPFWAQLRSPWLDTPNSYANNVLNF 11 NEKLAELQ+P ++ DWTQD FW QL SPW YA N+LNF Sbjct: 250 NEKLAELQLPKIIN-DWTQDQFWTQLNSPWFQNLTPYA-NILNF 291 >gb|AHY02159.1| NAC domain protein 78 [Gossypium hirsutum] Length = 291 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -2 Query: 142 NEKLAELQVPSRLSMDWTQDPFWAQLRSPWLDTPNSYANNVLNF 11 NEKLAELQ+P ++ DWTQD FW QL SPW YA N+LNF Sbjct: 250 NEKLAELQLPKIIN-DWTQDQFWTQLNSPWFQNLTPYA-NILNF 291 >gb|AGC27319.1| NAC domain protein 16 [Gossypium hirsutum] Length = 278 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -2 Query: 142 NEKLAELQVPSRLSMDWTQDPFWAQLRSPWLDTPNSYANNVLNF 11 NEKLAELQ+P ++ DWTQD FW QL SPW YA N+LNF Sbjct: 237 NEKLAELQLPKIIN-DWTQDQFWTQLNSPWFQNLTPYA-NILNF 278 >gb|AGC97441.1| NAC protein 11 [Gossypium hirsutum] Length = 291 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -2 Query: 142 NEKLAELQVPSRLSMDWTQDPFWAQLRSPWLDTPNSYANNVLNF 11 NEKLAELQ+P ++ DWTQD FW QL SPW YA N+LNF Sbjct: 250 NEKLAELQLPKIIN-DWTQDQFWTQLNSPWFQNLTPYA-NILNF 291