BLASTX nr result
ID: Gardenia21_contig00049386
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00049386 (356 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP10166.1| unnamed protein product [Coffea canephora] 59 1e-06 ref|XP_002534375.1| Ubiquitin ligase SINAT2, putative [Ricinus c... 57 7e-06 ref|XP_007029035.1| Seven in absentia of 2 isoform 1 [Theobroma ... 56 9e-06 >emb|CDP10166.1| unnamed protein product [Coffea canephora] Length = 372 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = -1 Query: 113 NPHFL-HSFYCIQVFNSYGKQFCLHFEAFQIGMAPVYM 3 NPH + ++ + + VFN YGKQFCLHFEAFQIGMAPVYM Sbjct: 254 NPHEVENATWMLTVFNCYGKQFCLHFEAFQIGMAPVYM 291 >ref|XP_002534375.1| Ubiquitin ligase SINAT2, putative [Ricinus communis] gi|223525415|gb|EEF28013.1| Ubiquitin ligase SINAT2, putative [Ricinus communis] Length = 304 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/38 (65%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = -1 Query: 113 NPHFL-HSFYCIQVFNSYGKQFCLHFEAFQIGMAPVYM 3 NPH + ++ + + VFN +G+QFCLHFEAFQIGMAPVYM Sbjct: 186 NPHEVENATWMLTVFNCFGRQFCLHFEAFQIGMAPVYM 223 >ref|XP_007029035.1| Seven in absentia of 2 isoform 1 [Theobroma cacao] gi|590637146|ref|XP_007029036.1| Seven in absentia of 2 isoform 1 [Theobroma cacao] gi|590637149|ref|XP_007029037.1| Seven in absentia of 2 isoform 1 [Theobroma cacao] gi|508717640|gb|EOY09537.1| Seven in absentia of 2 isoform 1 [Theobroma cacao] gi|508717641|gb|EOY09538.1| Seven in absentia of 2 isoform 1 [Theobroma cacao] gi|508717642|gb|EOY09539.1| Seven in absentia of 2 isoform 1 [Theobroma cacao] Length = 307 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/38 (65%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = -1 Query: 113 NPHFL-HSFYCIQVFNSYGKQFCLHFEAFQIGMAPVYM 3 NPH + ++ + + VFN +GKQFCLHFEAFQ GMAPVYM Sbjct: 189 NPHEVENATWMLTVFNCFGKQFCLHFEAFQFGMAPVYM 226