BLASTX nr result
ID: Gardenia21_contig00049296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00049296 (280 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP09196.1| unnamed protein product [Coffea canephora] 132 1e-28 >emb|CDP09196.1| unnamed protein product [Coffea canephora] Length = 795 Score = 132 bits (332), Expect = 1e-28 Identities = 69/93 (74%), Positives = 71/93 (76%) Frame = -1 Query: 280 TKNRLFLXXXXXXXXXXXXXXXXXAYCFYAGLCGNEHKSVYKPVGLQPTSARSNLEDYLA 101 TKNRLFL AYCF AGLCGNEHK+VYKPV LQPTSARSNLEDYLA Sbjct: 383 TKNRLFLAFGVVGCIGAFAGICTIAYCFCAGLCGNEHKNVYKPVVLQPTSARSNLEDYLA 442 Query: 100 ASNASILPPSGSSSINRYNSWILRCQRSGTSSR 2 ASNASILPPSGSSSI R NSW+LR QRSGTSSR Sbjct: 443 ASNASILPPSGSSSIKRNNSWVLRSQRSGTSSR 475