BLASTX nr result
ID: Gardenia21_contig00049127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00049127 (284 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP06665.1| unnamed protein product [Coffea canephora] 73 3e-12 >emb|CDP06665.1| unnamed protein product [Coffea canephora] Length = 652 Score = 73.2 bits (178), Expect(2) = 3e-12 Identities = 33/42 (78%), Positives = 40/42 (95%) Frame = -1 Query: 284 LSKKIIPVYREFYNKHKAVVMGSDRNLGSIVRFSPEDVGRYL 159 LS++I+PVYREFYNKHKAV++GS+R+LGSIVRFSPEDVG L Sbjct: 558 LSRRILPVYREFYNKHKAVMVGSERDLGSIVRFSPEDVGHCL 599 Score = 25.0 bits (53), Expect(2) = 3e-12 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 79 KFYTKVVGFTIRYILYF 29 K YT VGFT RY L F Sbjct: 628 KSYTSFVGFTTRYALSF 644