BLASTX nr result
ID: Gardenia21_contig00049070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00049070 (219 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP04645.1| unnamed protein product [Coffea canephora] 84 4e-14 >emb|CDP04645.1| unnamed protein product [Coffea canephora] Length = 266 Score = 84.0 bits (206), Expect = 4e-14 Identities = 42/55 (76%), Positives = 46/55 (83%), Gaps = 1/55 (1%) Frame = -3 Query: 163 DHQSSGEAVFLRGFQLLGVAVHRNLVQF-AFVRLLLKTSSLSFHGKAQCGISLKW 2 +H+S GEA FLR QLLGV+VHR LVQ FVRLLLKTSSLSFHGK QCG+SLKW Sbjct: 197 EHRSGGEAAFLREVQLLGVSVHRKLVQLIGFVRLLLKTSSLSFHGKLQCGMSLKW 251