BLASTX nr result
ID: Gardenia21_contig00047971
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00047971 (214 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJX98064.1| hypothetical protein TI39_contig440g00001 [Zymose... 140 5e-31 ref|XP_003850189.1| RNA binding zinc finger protein, RanBP2-type... 140 5e-31 gb|EMF12291.1| hypothetical protein SEPMUDRAFT_68057 [Sphaerulin... 135 9e-30 ref|XP_007927040.1| hypothetical protein MYCFIDRAFT_50263 [Pseud... 134 2e-29 gb|EME43522.1| hypothetical protein DOTSEDRAFT_45420 [Dothistrom... 132 1e-28 ref|XP_007678568.1| hypothetical protein BAUCODRAFT_26398 [Baudo... 131 2e-28 gb|KPI40876.1| putative RNA-binding protein [Phialophora attae] 96 8e-18 gb|KKY23193.1| putative rna binding protein [Phaeomoniella chlam... 96 1e-17 gb|KKY24856.1| putative rna binding protein [Diplodia seriata] 95 2e-17 gb|KIW07272.1| hypothetical protein PV09_02127 [Verruconis gallo... 95 2e-17 gb|KIV97229.1| hypothetical protein PV10_01004 [Exophiala mesoph... 95 2e-17 ref|XP_008715254.1| hypothetical protein HMPREF1541_02677 [Cyphe... 95 2e-17 ref|XP_007778286.1| hypothetical protein W97_02195 [Coniosporium... 95 2e-17 ref|XP_007585718.1| putative rna binding protein [Neofusicoccum ... 95 2e-17 gb|EKG19008.1| hypothetical protein MPH_03698 [Macrophomina phas... 95 2e-17 dbj|GAQ08821.1| uncharacterized RNA-binding protein C17H9.04c [A... 95 2e-17 dbj|GAO84590.1| uncharacterized RNA-binding protein C17H9.04c [N... 95 2e-17 ref|XP_013326164.1| RNA binding protein (Arp) [Rasamsonia emerso... 95 2e-17 ref|XP_002835079.1| hypothetical protein [Tuber melanosporum Mel... 95 2e-17 ref|XP_748126.1| RNA binding protein (Arp) [Aspergillus fumigatu... 95 2e-17 >gb|KJX98064.1| hypothetical protein TI39_contig440g00001 [Zymoseptoria brevis] Length = 730 Score = 140 bits (352), Expect = 5e-31 Identities = 70/71 (98%), Positives = 71/71 (100%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT Sbjct: 223 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 282 Query: 34 RCLNSLITKSR 2 RCLNSL+TKSR Sbjct: 283 RCLNSLVTKSR 293 >ref|XP_003850189.1| RNA binding zinc finger protein, RanBP2-type [Zymoseptoria tritici IPO323] gi|339470067|gb|EGP85165.1| RNA binding zinc finger protein, RanBP2-type [Zymoseptoria tritici IPO323] Length = 676 Score = 140 bits (352), Expect = 5e-31 Identities = 70/71 (98%), Positives = 71/71 (100%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT Sbjct: 196 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 255 Query: 34 RCLNSLITKSR 2 RCLNSL+TKSR Sbjct: 256 RCLNSLVTKSR 266 >gb|EMF12291.1| hypothetical protein SEPMUDRAFT_68057 [Sphaerulina musiva SO2202] Length = 716 Score = 135 bits (341), Expect = 9e-30 Identities = 68/71 (95%), Positives = 70/71 (98%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 QSHHPETLAFSS+SLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT Sbjct: 218 QSHHPETLAFSSSSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 277 Query: 34 RCLNSLITKSR 2 RCLNSL+ KSR Sbjct: 278 RCLNSLLKKSR 288 >ref|XP_007927040.1| hypothetical protein MYCFIDRAFT_50263 [Pseudocercospora fijiensis CIRAD86] gi|452982144|gb|EME81903.1| hypothetical protein MYCFIDRAFT_50263 [Pseudocercospora fijiensis CIRAD86] Length = 708 Score = 134 bits (338), Expect = 2e-29 Identities = 67/71 (94%), Positives = 70/71 (98%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 Q+HHPETLAFSS+SLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT Sbjct: 210 QAHHPETLAFSSSSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 269 Query: 34 RCLNSLITKSR 2 RCLNSL+ KSR Sbjct: 270 RCLNSLLKKSR 280 >gb|EME43522.1| hypothetical protein DOTSEDRAFT_45420 [Dothistroma septosporum NZE10] Length = 720 Score = 132 bits (332), Expect = 1e-28 Identities = 67/71 (94%), Positives = 68/71 (95%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 QSHHPETLAFSS+SLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT Sbjct: 221 QSHHPETLAFSSSSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 280 Query: 34 RCLNSLITKSR 2 RCL SL KSR Sbjct: 281 RCLTSLAKKSR 291 >ref|XP_007678568.1| hypothetical protein BAUCODRAFT_26398 [Baudoinia panamericana UAMH 10762] gi|449298206|gb|EMC94223.1| hypothetical protein BAUCODRAFT_26398 [Baudoinia panamericana UAMH 10762] Length = 787 Score = 131 bits (330), Expect = 2e-28 Identities = 66/70 (94%), Positives = 68/70 (97%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 QSHHPETLAFSS+SLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT Sbjct: 204 QSHHPETLAFSSSSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 263 Query: 34 RCLNSLITKS 5 RCL SL+ KS Sbjct: 264 RCLRSLLQKS 273 >gb|KPI40876.1| putative RNA-binding protein [Phialophora attae] Length = 629 Score = 96.3 bits (238), Expect = 8e-18 Identities = 47/71 (66%), Positives = 56/71 (78%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 Q HHPETL F +SL++ICA LEVE V+SS + LPFHLQALAP+SPRRA+EEA+TLT Sbjct: 158 QVHHPETLTFGPSSLANICAALEVEPVQSSAPIKHNLPFHLQALAPASPRRAMEEAITLT 217 Query: 34 RCLNSLITKSR 2 R L LI KS+ Sbjct: 218 RVLRGLIRKSQ 228 >gb|KKY23193.1| putative rna binding protein [Phaeomoniella chlamydospora] Length = 596 Score = 95.9 bits (237), Expect = 1e-17 Identities = 47/71 (66%), Positives = 56/71 (78%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 QSHHPE+L F +SLS+ICA LEVE V+SS + LPFHLQALAP+SPRRA+EEA+TL Sbjct: 155 QSHHPESLPFGPSSLSNICAALEVEPVQSSAPIKHNLPFHLQALAPASPRRAIEEAITLA 214 Query: 34 RCLNSLITKSR 2 R L LI KS+ Sbjct: 215 RVLRGLIRKSQ 225 >gb|KKY24856.1| putative rna binding protein [Diplodia seriata] Length = 613 Score = 95.1 bits (235), Expect = 2e-17 Identities = 46/71 (64%), Positives = 57/71 (80%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 Q+HHPE+L F S++LS+ICA LEVE V+SS + LPFHLQALAP+SPRRA+EEA+TL Sbjct: 155 QTHHPESLPFGSSALSNICAALEVEPVQSSAPIKHNLPFHLQALAPASPRRAMEEAVTLA 214 Query: 34 RCLNSLITKSR 2 R L LI KS+ Sbjct: 215 RVLRGLIRKSQ 225 >gb|KIW07272.1| hypothetical protein PV09_02127 [Verruconis gallopava] gi|759230298|gb|KIW07273.1| hypothetical protein, variant [Verruconis gallopava] Length = 620 Score = 95.1 bits (235), Expect = 2e-17 Identities = 46/71 (64%), Positives = 57/71 (80%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 Q+HHPE+L F S++LS+ICA LEVE V+SS + LPFHLQALAP++PRRALEEA+TL Sbjct: 157 QAHHPESLPFGSSALSNICAALEVEPVQSSAPIKHNLPFHLQALAPANPRRALEEAITLA 216 Query: 34 RCLNSLITKSR 2 R L LI KS+ Sbjct: 217 RVLRGLIRKSQ 227 >gb|KIV97229.1| hypothetical protein PV10_01004 [Exophiala mesophila] gi|759219893|gb|KIV97230.1| hypothetical protein, variant 1 [Exophiala mesophila] gi|759219894|gb|KIV97231.1| hypothetical protein, variant 2 [Exophiala mesophila] Length = 620 Score = 95.1 bits (235), Expect = 2e-17 Identities = 46/71 (64%), Positives = 56/71 (78%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 Q HHPE+L F +SL++ICA LEVE V+SS + LPFHLQALAP+SPRRA+EEA+TLT Sbjct: 155 QQHHPESLPFGPSSLANICAALEVEPVQSSAPIKHNLPFHLQALAPASPRRAMEEAITLT 214 Query: 34 RCLNSLITKSR 2 R L LI KS+ Sbjct: 215 RVLRGLIRKSQ 225 >ref|XP_008715254.1| hypothetical protein HMPREF1541_02677 [Cyphellophora europaea CBS 101466] gi|568120916|gb|ETN43518.1| hypothetical protein HMPREF1541_02677 [Cyphellophora europaea CBS 101466] Length = 621 Score = 95.1 bits (235), Expect = 2e-17 Identities = 46/71 (64%), Positives = 56/71 (78%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 Q HHPE+L F +SL++ICA LEVE V+SS + LPFHLQALAP+SPRRA+EEA+TLT Sbjct: 157 QQHHPESLPFGPSSLANICAALEVEPVQSSAPIKHNLPFHLQALAPASPRRAMEEAITLT 216 Query: 34 RCLNSLITKSR 2 R L LI KS+ Sbjct: 217 RVLRGLIRKSQ 227 >ref|XP_007778286.1| hypothetical protein W97_02195 [Coniosporium apollinis CBS 100218] gi|494825839|gb|EON62969.1| hypothetical protein W97_02195 [Coniosporium apollinis CBS 100218] Length = 616 Score = 95.1 bits (235), Expect = 2e-17 Identities = 46/71 (64%), Positives = 57/71 (80%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 Q+HHPE+L F S++LS+ICA LEVE V+SS + LPFHLQALAP+SPRRA+EEA+TL Sbjct: 155 QAHHPESLPFGSSALSNICAALEVEPVQSSAPIKHNLPFHLQALAPASPRRAMEEAVTLA 214 Query: 34 RCLNSLITKSR 2 R L LI KS+ Sbjct: 215 RVLRGLIRKSQ 225 >ref|XP_007585718.1| putative rna binding protein [Neofusicoccum parvum UCRNP2] gi|485920955|gb|EOD46814.1| putative rna binding protein [Neofusicoccum parvum UCRNP2] Length = 615 Score = 95.1 bits (235), Expect = 2e-17 Identities = 46/71 (64%), Positives = 57/71 (80%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 Q+HHPE+L F S++LS+ICA LEVE V+SS + LPFHLQALAP+SPRRA+EEA+TL Sbjct: 155 QAHHPESLPFGSSALSNICAALEVEPVQSSAPIKHNLPFHLQALAPASPRRAMEEAVTLA 214 Query: 34 RCLNSLITKSR 2 R L LI KS+ Sbjct: 215 RVLRGLIRKSQ 225 >gb|EKG19008.1| hypothetical protein MPH_03698 [Macrophomina phaseolina MS6] Length = 633 Score = 95.1 bits (235), Expect = 2e-17 Identities = 46/71 (64%), Positives = 57/71 (80%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 Q+HHPE+L F S++LS+ICA LEVE V+SS + LPFHLQALAP+SPRRA+EEA+TL Sbjct: 155 QAHHPESLPFGSSALSNICAALEVEPVQSSAPIKHNLPFHLQALAPASPRRAMEEAVTLA 214 Query: 34 RCLNSLITKSR 2 R L LI KS+ Sbjct: 215 RVLRGLIRKSQ 225 >dbj|GAQ08821.1| uncharacterized RNA-binding protein C17H9.04c [Aspergillus lentulus] Length = 613 Score = 94.7 bits (234), Expect = 2e-17 Identities = 46/71 (64%), Positives = 56/71 (78%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 Q+HHPE+L F +SLS+ICA LEVE V+SS + LPFHLQALAP+SPRRA+EEA+TL Sbjct: 155 QTHHPESLPFGPSSLSNICAALEVEPVQSSAPIKHNLPFHLQALAPASPRRAMEEAITLA 214 Query: 34 RCLNSLITKSR 2 R L LI KS+ Sbjct: 215 RVLRGLIRKSQ 225 >dbj|GAO84590.1| uncharacterized RNA-binding protein C17H9.04c [Neosartorya udagawae] Length = 613 Score = 94.7 bits (234), Expect = 2e-17 Identities = 46/71 (64%), Positives = 56/71 (78%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 Q+HHPE+L F +SLS+ICA LEVE V+SS + LPFHLQALAP+SPRRA+EEA+TL Sbjct: 155 QTHHPESLPFGPSSLSNICAALEVEPVQSSAPIKHNLPFHLQALAPASPRRAMEEAITLA 214 Query: 34 RCLNSLITKSR 2 R L LI KS+ Sbjct: 215 RVLRGLIRKSQ 225 >ref|XP_013326164.1| RNA binding protein (Arp) [Rasamsonia emersonii CBS 393.64] gi|802089676|gb|KKA19552.1| RNA binding protein (Arp) [Rasamsonia emersonii CBS 393.64] Length = 614 Score = 94.7 bits (234), Expect = 2e-17 Identities = 46/71 (64%), Positives = 56/71 (78%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 Q+HHPE+L F +SLS+ICA LEVE V+SS + LPFHLQALAP+SPRRA+EEA+TL Sbjct: 155 QTHHPESLPFGPSSLSNICAALEVEPVQSSAPIKHNLPFHLQALAPASPRRAMEEAITLA 214 Query: 34 RCLNSLITKSR 2 R L LI KS+ Sbjct: 215 RVLRGLIRKSQ 225 >ref|XP_002835079.1| hypothetical protein [Tuber melanosporum Mel28] gi|295627854|emb|CAZ79200.1| unnamed protein product [Tuber melanosporum] Length = 596 Score = 94.7 bits (234), Expect = 2e-17 Identities = 46/71 (64%), Positives = 56/71 (78%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 QSHHPE+L F +SL++ICA LEVE V+SS + LPFHLQALAP+SPRRA+EEA+TL Sbjct: 145 QSHHPESLPFGPSSLANICAALEVEPVQSSAPIKHNLPFHLQALAPASPRRAMEEAITLA 204 Query: 34 RCLNSLITKSR 2 R L LI KS+ Sbjct: 205 RVLRGLIKKSQ 215 >ref|XP_748126.1| RNA binding protein (Arp) [Aspergillus fumigatus Af293] gi|66845754|gb|EAL86088.1| RNA binding protein (Arp), putative [Aspergillus fumigatus Af293] gi|159125951|gb|EDP51067.1| RNA binding protein (Arp), putative [Aspergillus fumigatus A1163] gi|846913153|gb|KMK58981.1| RNA binding protein (Arp) [Aspergillus fumigatus Z5] Length = 613 Score = 94.7 bits (234), Expect = 2e-17 Identities = 46/71 (64%), Positives = 56/71 (78%) Frame = -1 Query: 214 QSHHPETLAFSSTSLSSICAGLEVEEVRSSGKVTGGLPFHLQALAPSSPRRALEEALTLT 35 Q+HHPE+L F +SLS+ICA LEVE V+SS + LPFHLQALAP+SPRRA+EEA+TL Sbjct: 155 QTHHPESLPFGPSSLSNICAALEVEPVQSSAPIKHNLPFHLQALAPASPRRAMEEAITLA 214 Query: 34 RCLNSLITKSR 2 R L LI KS+ Sbjct: 215 RVLRGLIRKSQ 225