BLASTX nr result
ID: Gardenia21_contig00047727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00047727 (288 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME39384.1| hypothetical protein DOTSEDRAFT_28543 [Dothistrom... 68 2e-09 gb|EMF10038.1| hypothetical protein SEPMUDRAFT_151102 [Sphaeruli... 57 7e-06 >gb|EME39384.1| hypothetical protein DOTSEDRAFT_28543 [Dothistroma septosporum NZE10] Length = 83 Score = 68.2 bits (165), Expect = 2e-09 Identities = 37/54 (68%), Positives = 39/54 (72%), Gaps = 2/54 (3%) Frame = -1 Query: 285 GTNALFSGMQEYKRGSN--ASEQRRTSLADQSAKPQGGMLANMWNSTFKGGNSK 130 G LFSGMQEYKR N A + RR SL DQSAKP G MLANMWNSTFKG + K Sbjct: 31 GGTQLFSGMQEYKRDPNSAAGQARRESLQDQSAKPSG-MLANMWNSTFKGADKK 83 >gb|EMF10038.1| hypothetical protein SEPMUDRAFT_151102 [Sphaerulina musiva SO2202] Length = 118 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/54 (51%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = -1 Query: 288 QGTNALFSGMQEYKRGSN-ASEQRRTSLADQSAKPQGGMLANMWNSTFKGGNSK 130 +G+ LFSG++ YKR A++QRR SL D KP G +AN+WN+TFKGG+ K Sbjct: 67 KGSGTLFSGIEHYKRQDGPAAKQRRDSLKDMQPKP--GFIANLWNNTFKGGDLK 118