BLASTX nr result
ID: Gardenia21_contig00047559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00047559 (255 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009783883.1| PREDICTED: pentatricopeptide repeat-containi... 77 5e-12 ref|XP_009620070.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-10 ref|XP_008354409.1| PREDICTED: pentatricopeptide repeat-containi... 70 8e-10 ref|XP_004149831.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-09 ref|XP_009343975.1| PREDICTED: pentatricopeptide repeat-containi... 67 7e-09 ref|XP_004292714.1| PREDICTED: pentatricopeptide repeat-containi... 66 9e-09 ref|XP_006351204.1| PREDICTED: pentatricopeptide repeat-containi... 65 2e-08 ref|XP_008463528.1| PREDICTED: pentatricopeptide repeat-containi... 65 3e-08 ref|XP_012853286.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_010324829.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 ref|XP_010063939.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 gb|KCW71237.1| hypothetical protein EUGRSUZ_F04334 [Eucalyptus g... 64 4e-08 ref|XP_010324828.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 ref|XP_010253174.1| PREDICTED: pentatricopeptide repeat-containi... 64 6e-08 ref|XP_008219723.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 ref|XP_010095425.1| hypothetical protein L484_013382 [Morus nota... 62 1e-07 gb|EYU23868.1| hypothetical protein MIMGU_mgv1a005901mg [Erythra... 62 1e-07 ref|XP_010277208.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_012452558.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-07 ref|XP_011074826.1| PREDICTED: pentatricopeptide repeat-containi... 60 5e-07 >ref|XP_009783883.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Nicotiana sylvestris] Length = 447 Score = 77.0 bits (188), Expect = 5e-12 Identities = 40/72 (55%), Positives = 49/72 (68%) Frame = -3 Query: 217 SQTPFVNQILAAIIKNQSFETNASSSASVQSIPRAKIPIWTTETVTEVLRFIPIFLFQSA 38 +Q +NQ+LAAII+N+ FE N S+S Q PIWT E V++VLR IPI+LFQS Sbjct: 13 TQNLLINQVLAAIIRNRPFEKNVSASIPNQ-------PIWTVEAVSQVLRSIPIYLFQSP 65 Query: 37 RSIGNQKGFGHR 2 RSIG Q GF HR Sbjct: 66 RSIGRQSGFRHR 77 >ref|XP_009620070.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Nicotiana tomentosiformis] Length = 447 Score = 72.0 bits (175), Expect = 2e-10 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 2/74 (2%) Frame = -3 Query: 217 SQTPFVNQILAAIIKNQS--FETNASSSASVQSIPRAKIPIWTTETVTEVLRFIPIFLFQ 44 +Q +NQ+LAAII+N++ FETN ++S IP K PIWT E V++VLR IP +LFQ Sbjct: 13 TQNLLINQVLAAIIRNRNRPFETNVAAS-----IP--KQPIWTVEAVSQVLRSIPRYLFQ 65 Query: 43 SARSIGNQKGFGHR 2 S RSIG Q GF HR Sbjct: 66 SPRSIGRQSGFRHR 79 >ref|XP_008354409.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Malus domestica] Length = 452 Score = 69.7 bits (169), Expect = 8e-10 Identities = 37/71 (52%), Positives = 50/71 (70%), Gaps = 2/71 (2%) Frame = -3 Query: 208 PFVNQILAAIIKNQSFETN--ASSSASVQSIPRAKIPIWTTETVTEVLRFIPIFLFQSAR 35 P VNQ+LAA++KNQ F++N AS++AS + A P WT ++V++VL IP F FQS R Sbjct: 9 PIVNQVLAAMLKNQPFDSNLAASAAASAAASAAASQP-WTADSVSQVLISIPRFFFQSPR 67 Query: 34 SIGNQKGFGHR 2 S+G Q GF HR Sbjct: 68 SVGRQTGFRHR 78 >ref|XP_004149831.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Cucumis sativus] gi|700196080|gb|KGN51257.1| hypothetical protein Csa_5G505180 [Cucumis sativus] Length = 445 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/67 (49%), Positives = 50/67 (74%) Frame = -3 Query: 202 VNQILAAIIKNQSFETNASSSASVQSIPRAKIPIWTTETVTEVLRFIPIFLFQSARSIGN 23 V+QIL A++KN+ F+T+ S+AS + + +W++++V++VLR +P F FQSARSIG Sbjct: 15 VDQILVAMLKNRPFDTHVHSAASTSTTHQ----LWSSDSVSDVLRSVPRFFFQSARSIGT 70 Query: 22 QKGFGHR 2 QKGF HR Sbjct: 71 QKGFRHR 77 >ref|XP_009343975.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Pyrus x bretschneideri] Length = 444 Score = 66.6 bits (161), Expect = 7e-09 Identities = 33/69 (47%), Positives = 46/69 (66%) Frame = -3 Query: 208 PFVNQILAAIIKNQSFETNASSSASVQSIPRAKIPIWTTETVTEVLRFIPIFLFQSARSI 29 P VNQ+LAA++KNQ F++N ++SA+ WT ++V++VL IP F FQS RS+ Sbjct: 9 PIVNQVLAAMLKNQPFDSNLAASAAASQP-------WTADSVSQVLISIPRFFFQSPRSV 61 Query: 28 GNQKGFGHR 2 G Q GF HR Sbjct: 62 GRQTGFRHR 70 >ref|XP_004292714.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Fragaria vesca subsp. vesca] Length = 444 Score = 66.2 bits (160), Expect = 9e-09 Identities = 34/72 (47%), Positives = 43/72 (59%) Frame = -3 Query: 217 SQTPFVNQILAAIIKNQSFETNASSSASVQSIPRAKIPIWTTETVTEVLRFIPIFLFQSA 38 + TP VNQ+L A++KNQ F+ N S S WTT++V++VL IP F F S Sbjct: 11 NHTPLVNQVLTAMLKNQPFDPNPSPSTQP----------WTTDSVSQVLTSIPTFFFHSP 60 Query: 37 RSIGNQKGFGHR 2 RSIG Q GF HR Sbjct: 61 RSIGRQPGFRHR 72 >ref|XP_006351204.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Solanum tuberosum] Length = 440 Score = 65.1 bits (157), Expect = 2e-08 Identities = 36/74 (48%), Positives = 46/74 (62%) Frame = -3 Query: 223 PPSQTPFVNQILAAIIKNQSFETNASSSASVQSIPRAKIPIWTTETVTEVLRFIPIFLFQ 44 P Q ++Q++AAII+N+SFE + PIWT ETV++VLR IP FLFQ Sbjct: 10 PFIQNLVMDQVMAAIIRNRSFEASILQ------------PIWTVETVSQVLRSIPRFLFQ 57 Query: 43 SARSIGNQKGFGHR 2 S RSIG Q GF +R Sbjct: 58 SPRSIGRQNGFRYR 71 >ref|XP_008463528.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Cucumis melo] gi|659127108|ref|XP_008463529.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Cucumis melo] Length = 445 Score = 64.7 bits (156), Expect = 3e-08 Identities = 31/67 (46%), Positives = 49/67 (73%) Frame = -3 Query: 202 VNQILAAIIKNQSFETNASSSASVQSIPRAKIPIWTTETVTEVLRFIPIFLFQSARSIGN 23 V+QIL A+++N+ F+T+ +AS + + +W++++V++VLR +P F FQSARSIG Sbjct: 15 VDQILVAMLQNRPFDTHIHPAASTSTTHQ----LWSSDSVSDVLRSVPRFFFQSARSIGT 70 Query: 22 QKGFGHR 2 QKGF HR Sbjct: 71 QKGFRHR 77 >ref|XP_012853286.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Erythranthe guttatus] Length = 460 Score = 64.3 bits (155), Expect = 3e-08 Identities = 36/83 (43%), Positives = 50/83 (60%) Frame = -3 Query: 250 MNPSAPRHRPPSQTPFVNQILAAIIKNQSFETNASSSASVQSIPRAKIPIWTTETVTEVL 71 ++P+ P H ++Q++AAII+N+ F+T S P IWT+ETV +VL Sbjct: 23 LHPTQPNH-------LISQVVAAIIQNRPFDTAPS--------PHHHQRIWTSETVIQVL 67 Query: 70 RFIPIFLFQSARSIGNQKGFGHR 2 R IP+ LFQS+RSIG Q F HR Sbjct: 68 RSIPLHLFQSSRSIGRQNTFRHR 90 >ref|XP_010324829.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 isoform X2 [Solanum lycopersicum] Length = 407 Score = 63.9 bits (154), Expect = 4e-08 Identities = 36/67 (53%), Positives = 46/67 (68%) Frame = -3 Query: 202 VNQILAAIIKNQSFETNASSSASVQSIPRAKIPIWTTETVTEVLRFIPIFLFQSARSIGN 23 ++Q +AAII+N+ FE+ SIP++ IWT ETV++VLR IP FLFQS RSIG Sbjct: 1 MDQAMAAIIRNRPFES---------SIPQS---IWTVETVSQVLRSIPRFLFQSPRSIGR 48 Query: 22 QKGFGHR 2 Q GF HR Sbjct: 49 QNGFRHR 55 >ref|XP_010063939.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Eucalyptus grandis] Length = 442 Score = 63.9 bits (154), Expect = 4e-08 Identities = 38/83 (45%), Positives = 50/83 (60%) Frame = -3 Query: 250 MNPSAPRHRPPSQTPFVNQILAAIIKNQSFETNASSSASVQSIPRAKIPIWTTETVTEVL 71 M S P +R + VNQ+LA I++N+ F+ ++SA+ S P W TE+V+EVL Sbjct: 1 MISSRPLNR--NYVSIVNQVLAVIVQNREFDAKLAASAAPTSPP------WDTESVSEVL 52 Query: 70 RFIPIFLFQSARSIGNQKGFGHR 2 R IP FQS RSIG QK F HR Sbjct: 53 RSIPRCFFQSPRSIGRQKTFRHR 75 >gb|KCW71237.1| hypothetical protein EUGRSUZ_F04334 [Eucalyptus grandis] Length = 448 Score = 63.9 bits (154), Expect = 4e-08 Identities = 38/83 (45%), Positives = 50/83 (60%) Frame = -3 Query: 250 MNPSAPRHRPPSQTPFVNQILAAIIKNQSFETNASSSASVQSIPRAKIPIWTTETVTEVL 71 M S P +R + VNQ+LA I++N+ F+ ++SA+ S P W TE+V+EVL Sbjct: 1 MISSRPLNR--NYVSIVNQVLAVIVQNREFDAKLAASAAPTSPP------WDTESVSEVL 52 Query: 70 RFIPIFLFQSARSIGNQKGFGHR 2 R IP FQS RSIG QK F HR Sbjct: 53 RSIPRCFFQSPRSIGRQKTFRHR 75 >ref|XP_010324828.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 isoform X1 [Solanum lycopersicum] Length = 426 Score = 63.9 bits (154), Expect = 4e-08 Identities = 36/67 (53%), Positives = 46/67 (68%) Frame = -3 Query: 202 VNQILAAIIKNQSFETNASSSASVQSIPRAKIPIWTTETVTEVLRFIPIFLFQSARSIGN 23 ++Q +AAII+N+ FE+ SIP++ IWT ETV++VLR IP FLFQS RSIG Sbjct: 1 MDQAMAAIIRNRPFES---------SIPQS---IWTVETVSQVLRSIPRFLFQSPRSIGR 48 Query: 22 QKGFGHR 2 Q GF HR Sbjct: 49 QNGFRHR 55 >ref|XP_010253174.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Nelumbo nucifera] Length = 492 Score = 63.5 bits (153), Expect = 6e-08 Identities = 33/72 (45%), Positives = 45/72 (62%) Frame = -3 Query: 217 SQTPFVNQILAAIIKNQSFETNASSSASVQSIPRAKIPIWTTETVTEVLRFIPIFLFQSA 38 S+T V+Q++ +++++ F+ ++S I R WT E V EVLR IP F FQSA Sbjct: 52 SRTSLVSQVIVVMLQDRPFDAQTAAS-----ITRLNFNPWTVEIVCEVLRSIPRFFFQSA 106 Query: 37 RSIGNQKGFGHR 2 RSIG QKGF HR Sbjct: 107 RSIGRQKGFRHR 118 >ref|XP_008219723.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Prunus mume] Length = 449 Score = 63.2 bits (152), Expect = 7e-08 Identities = 39/84 (46%), Positives = 51/84 (60%), Gaps = 1/84 (1%) Frame = -3 Query: 250 MNPSAPRHRPPSQTP-FVNQILAAIIKNQSFETNASSSASVQSIPRAKIPIWTTETVTEV 74 MN S P R + TP VNQ+L A++KNQ F + ++SA+ WT+E+V++V Sbjct: 1 MNHSKPLCR--NYTPNVVNQVLTAMLKNQPFNSELAASATTSQP-------WTSESVSQV 51 Query: 73 LRFIPIFLFQSARSIGNQKGFGHR 2 L IP F FQS RSIG Q GF HR Sbjct: 52 LISIPRFFFQSPRSIGRQHGFRHR 75 >ref|XP_010095425.1| hypothetical protein L484_013382 [Morus notabilis] gi|587870841|gb|EXB60117.1| hypothetical protein L484_013382 [Morus notabilis] Length = 444 Score = 62.4 bits (150), Expect = 1e-07 Identities = 33/70 (47%), Positives = 45/70 (64%) Frame = -3 Query: 211 TPFVNQILAAIIKNQSFETNASSSASVQSIPRAKIPIWTTETVTEVLRFIPIFLFQSARS 32 T VNQIL A+++N+ F+++ +SS+ W+ E V+EVLR +P F FQS RS Sbjct: 12 TRIVNQILTAMLQNRPFDSHLTSSSLR----------WSAEAVSEVLRSVPRFFFQSPRS 61 Query: 31 IGNQKGFGHR 2 IG QKGF HR Sbjct: 62 IGRQKGFRHR 71 >gb|EYU23868.1| hypothetical protein MIMGU_mgv1a005901mg [Erythranthe guttata] Length = 465 Score = 62.4 bits (150), Expect = 1e-07 Identities = 34/66 (51%), Positives = 43/66 (65%) Frame = -3 Query: 199 NQILAAIIKNQSFETNASSSASVQSIPRAKIPIWTTETVTEVLRFIPIFLFQSARSIGNQ 20 NQ++AAII+N+ F+T S P IWT+ETV +VLR IP+ LFQS+RSIG Q Sbjct: 38 NQVVAAIIQNRPFDTAPS--------PHHHQRIWTSETVIQVLRSIPLHLFQSSRSIGRQ 89 Query: 19 KGFGHR 2 F HR Sbjct: 90 NTFRHR 95 >ref|XP_010277208.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Nelumbo nucifera] Length = 493 Score = 61.2 bits (147), Expect = 3e-07 Identities = 32/71 (45%), Positives = 44/71 (61%) Frame = -3 Query: 214 QTPFVNQILAAIIKNQSFETNASSSASVQSIPRAKIPIWTTETVTEVLRFIPIFLFQSAR 35 +T V+Q++ +++++ F+ ++S I R WT ETV EVLR I F FQSAR Sbjct: 53 RTSLVSQVMVVMLQDKPFDAQTAAS-----ITRLNFNPWTVETVCEVLRSITRFFFQSAR 107 Query: 34 SIGNQKGFGHR 2 SIG QKGF HR Sbjct: 108 SIGRQKGFRHR 118 >ref|XP_012452558.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Gossypium raimondii] gi|823239832|ref|XP_012452559.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Gossypium raimondii] gi|763797556|gb|KJB64511.1| hypothetical protein B456_010G052600 [Gossypium raimondii] gi|763797557|gb|KJB64512.1| hypothetical protein B456_010G052600 [Gossypium raimondii] Length = 448 Score = 60.5 bits (145), Expect = 5e-07 Identities = 32/83 (38%), Positives = 49/83 (59%) Frame = -3 Query: 250 MNPSAPRHRPPSQTPFVNQILAAIIKNQSFETNASSSASVQSIPRAKIPIWTTETVTEVL 71 M P+ P R S V+Q+++ +++N+ F+ +SS WTT++V+++L Sbjct: 1 MFPTKPLQR--SSDGIVHQVMSMMVQNRPFDAQLASSTISNP--------WTTDSVSDIL 50 Query: 70 RFIPIFLFQSARSIGNQKGFGHR 2 R +P F FQS RSIG QKGF HR Sbjct: 51 RSVPKFFFQSLRSIGRQKGFRHR 73 >ref|XP_011074826.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Sesamum indicum] Length = 449 Score = 60.5 bits (145), Expect = 5e-07 Identities = 37/84 (44%), Positives = 48/84 (57%) Frame = -3 Query: 253 YMNPSAPRHRPPSQTPFVNQILAAIIKNQSFETNASSSASVQSIPRAKIPIWTTETVTEV 74 +++P R V Q+L AII+N+ F NA S P IWT+ETV +V Sbjct: 2 FVSPPFLRRFSTQSNHLVGQVLGAIIQNRPF--NAIS-------PPHHNFIWTSETVIQV 52 Query: 73 LRFIPIFLFQSARSIGNQKGFGHR 2 LR IP++LFQS RSIG Q+ F HR Sbjct: 53 LRSIPLYLFQSPRSIGRQRSFRHR 76