BLASTX nr result
ID: Gardenia21_contig00046467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00046467 (245 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03049.1| unnamed protein product [Coffea canephora] 77 7e-12 ref|XP_013463581.1| auxin response factor 2 [Medicago truncatula... 74 3e-11 gb|KHN07880.1| Auxin response factor 19 [Glycine soja] 72 2e-10 ref|XP_003542373.1| PREDICTED: auxin response factor 19-like [Gl... 72 2e-10 ref|NP_001292622.1| auxin response factor 19 [Cucumis sativus] g... 71 3e-10 ref|XP_011648572.1| PREDICTED: auxin response factor 19 isoform ... 71 3e-10 ref|XP_008460049.1| PREDICTED: auxin response factor 19 isoform ... 71 3e-10 ref|XP_008460042.1| PREDICTED: auxin response factor 19 isoform ... 71 3e-10 ref|XP_008460034.1| PREDICTED: auxin response factor 19 isoform ... 71 3e-10 ref|XP_011648570.1| PREDICTED: auxin response factor 19 isoform ... 71 3e-10 gb|KHN12303.1| Auxin response factor 19 [Glycine soja] 71 4e-10 ref|XP_003533798.1| PREDICTED: auxin response factor 19-like [Gl... 71 4e-10 gb|KHN17743.1| Auxin response factor 7 [Glycine soja] 70 5e-10 ref|XP_009791842.1| PREDICTED: auxin response factor 19-like [Ni... 70 5e-10 ref|XP_009620963.1| PREDICTED: auxin response factor 19-like [Ni... 70 5e-10 ref|XP_013458391.1| auxin response factor 2 [Medicago truncatula... 70 5e-10 ref|XP_003551063.1| PREDICTED: auxin response factor 19-like [Gl... 70 5e-10 ref|XP_003609970.1| auxin response factor 2 [Medicago truncatula... 70 5e-10 ref|XP_009359710.1| PREDICTED: auxin response factor 19 [Pyrus x... 70 6e-10 ref|XP_006353789.1| PREDICTED: auxin response factor 7-like [Sol... 70 6e-10 >emb|CDP03049.1| unnamed protein product [Coffea canephora] Length = 1079 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL Sbjct: 1 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 35 >ref|XP_013463581.1| auxin response factor 2 [Medicago truncatula] gi|657397980|gb|KEH37616.1| auxin response factor 2 [Medicago truncatula] Length = 1114 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAP+NGYLANSGEGERKAINSELWHACAGPLVS+ Sbjct: 1 MKAPSNGYLANSGEGERKAINSELWHACAGPLVSI 35 >gb|KHN07880.1| Auxin response factor 19 [Glycine soja] Length = 1130 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAP+NGYL NSGEGERK INSELWHACAGPLVSL Sbjct: 1 MKAPSNGYLPNSGEGERKTINSELWHACAGPLVSL 35 >ref|XP_003542373.1| PREDICTED: auxin response factor 19-like [Glycine max] gi|947070464|gb|KRH19355.1| hypothetical protein GLYMA_13G112600 [Glycine max] Length = 1131 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAP+NGYL NSGEGERK INSELWHACAGPLVSL Sbjct: 1 MKAPSNGYLPNSGEGERKTINSELWHACAGPLVSL 35 >ref|NP_001292622.1| auxin response factor 19 [Cucumis sativus] gi|47496692|dbj|BAD19061.1| auxin response factor 1 [Cucumis sativus] Length = 1081 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAP+NG+LANSGEGERK INSELWHACAGPLVSL Sbjct: 1 MKAPSNGFLANSGEGERKNINSELWHACAGPLVSL 35 >ref|XP_011648572.1| PREDICTED: auxin response factor 19 isoform X2 [Cucumis sativus] Length = 944 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAP+NG+LANSGEGERK INSELWHACAGPLVSL Sbjct: 1 MKAPSNGFLANSGEGERKNINSELWHACAGPLVSL 35 >ref|XP_008460049.1| PREDICTED: auxin response factor 19 isoform X3 [Cucumis melo] Length = 994 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAP+NG+LANSGEGERK INSELWHACAGPLVSL Sbjct: 1 MKAPSNGFLANSGEGERKNINSELWHACAGPLVSL 35 >ref|XP_008460042.1| PREDICTED: auxin response factor 19 isoform X2 [Cucumis melo] Length = 1102 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAP+NG+LANSGEGERK INSELWHACAGPLVSL Sbjct: 1 MKAPSNGFLANSGEGERKNINSELWHACAGPLVSL 35 >ref|XP_008460034.1| PREDICTED: auxin response factor 19 isoform X1 [Cucumis melo] Length = 1110 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAP+NG+LANSGEGERK INSELWHACAGPLVSL Sbjct: 1 MKAPSNGFLANSGEGERKNINSELWHACAGPLVSL 35 >ref|XP_011648570.1| PREDICTED: auxin response factor 19 isoform X1 [Cucumis sativus] gi|778665471|ref|XP_011648571.1| PREDICTED: auxin response factor 19 isoform X1 [Cucumis sativus] gi|700205375|gb|KGN60494.1| hypothetical protein Csa_2G000030 [Cucumis sativus] Length = 1097 Score = 71.2 bits (173), Expect = 3e-10 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAP+NG+LANSGEGERK INSELWHACAGPLVSL Sbjct: 1 MKAPSNGFLANSGEGERKNINSELWHACAGPLVSL 35 >gb|KHN12303.1| Auxin response factor 19 [Glycine soja] Length = 1125 Score = 70.9 bits (172), Expect = 4e-10 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAP NGYL NSGEGERK INSELWHACAGPLVSL Sbjct: 1 MKAPPNGYLPNSGEGERKTINSELWHACAGPLVSL 35 >ref|XP_003533798.1| PREDICTED: auxin response factor 19-like [Glycine max] gi|947088871|gb|KRH37536.1| hypothetical protein GLYMA_09G072200 [Glycine max] Length = 1125 Score = 70.9 bits (172), Expect = 4e-10 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAP NGYL NSGEGERK INSELWHACAGPLVSL Sbjct: 1 MKAPPNGYLPNSGEGERKTINSELWHACAGPLVSL 35 >gb|KHN17743.1| Auxin response factor 7 [Glycine soja] Length = 1189 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAP+NGYL NSGEGERK +NSELWHACAGPLVSL Sbjct: 53 MKAPSNGYLPNSGEGERKTMNSELWHACAGPLVSL 87 >ref|XP_009791842.1| PREDICTED: auxin response factor 19-like [Nicotiana sylvestris] Length = 1090 Score = 70.5 bits (171), Expect = 5e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAP+NGY+ANSGEG+RK +NSELWHACAGPLVSL Sbjct: 1 MKAPSNGYIANSGEGDRKVMNSELWHACAGPLVSL 35 >ref|XP_009620963.1| PREDICTED: auxin response factor 19-like [Nicotiana tomentosiformis] Length = 1078 Score = 70.5 bits (171), Expect = 5e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAP+NGY+ANSGEG+RK +NSELWHACAGPLVSL Sbjct: 1 MKAPSNGYIANSGEGDRKVMNSELWHACAGPLVSL 35 >ref|XP_013458391.1| auxin response factor 2 [Medicago truncatula] gi|657391083|gb|KEH32422.1| auxin response factor 2 [Medicago truncatula] Length = 1097 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAP NGY+ NSGEGERK INSELWHACAGPLVSL Sbjct: 1 MKAPNNGYMPNSGEGERKTINSELWHACAGPLVSL 35 >ref|XP_003551063.1| PREDICTED: auxin response factor 19-like [Glycine max] gi|947053122|gb|KRH02575.1| hypothetical protein GLYMA_17G047100 [Glycine max] Length = 1136 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAP+NGYL NSGEGERK +NSELWHACAGPLVSL Sbjct: 1 MKAPSNGYLPNSGEGERKTMNSELWHACAGPLVSL 35 >ref|XP_003609970.1| auxin response factor 2 [Medicago truncatula] gi|355511025|gb|AES92167.1| auxin response factor 2 [Medicago truncatula] Length = 1120 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAP NGY+ NSGEGERK INSELWHACAGPLVSL Sbjct: 1 MKAPNNGYMPNSGEGERKTINSELWHACAGPLVSL 35 >ref|XP_009359710.1| PREDICTED: auxin response factor 19 [Pyrus x bretschneideri] Length = 1108 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MK PTNG+LANSGEGE+K INSELWHACAGPLVSL Sbjct: 1 MKVPTNGFLANSGEGEQKRINSELWHACAGPLVSL 35 >ref|XP_006353789.1| PREDICTED: auxin response factor 7-like [Solanum tuberosum] Length = 1157 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 107 MKAPTNGYLANSGEGERKAINSELWHACAGPLVSL 3 MKAP+NGYL NSGEGERK +NSELWHACAGPLVSL Sbjct: 1 MKAPSNGYLPNSGEGERKLMNSELWHACAGPLVSL 35