BLASTX nr result
ID: Gardenia21_contig00046423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00046423 (322 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005648653.1| chlorophyll a/b-binding protein [Coccomyxa s... 72 2e-10 >ref|XP_005648653.1| chlorophyll a/b-binding protein [Coccomyxa subellipsoidea C-169] gi|384250630|gb|EIE24109.1| chlorophyll a/b-binding protein [Coccomyxa subellipsoidea C-169] Length = 181 Score = 72.0 bits (175), Expect = 2e-10 Identities = 37/65 (56%), Positives = 44/65 (67%) Frame = +3 Query: 126 PTGVDRTDTRNIEAGNISNENAERRADIGKERIPTFPEVQAFDGPAPETINGSLCMIACA 305 P VDR+ NIEAGN+SNENAERRAD G ++ F +QAFDG APETIN L M+ Sbjct: 3 PGTVDRSKISNIEAGNLSNENAERRADAGPDQ--PFTSIQAFDGVAPETINSRLAMLGVT 60 Query: 306 STIGA 320 S + A Sbjct: 61 SALAA 65