BLASTX nr result
ID: Gardenia21_contig00046420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00046420 (220 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP07077.1| unnamed protein product [Coffea canephora] 70 5e-10 >emb|CDP07077.1| unnamed protein product [Coffea canephora] Length = 343 Score = 70.5 bits (171), Expect = 5e-10 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = -1 Query: 220 VHYNSIYPEGDLIRLETKRKKRRSVPRQEHFQTPDDCS 107 VHYNSIYPEGDL TKRKKRRS PRQEHF+ PDDCS Sbjct: 306 VHYNSIYPEGDLTTFGTKRKKRRSFPRQEHFEIPDDCS 343