BLASTX nr result
ID: Gardenia21_contig00046303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00046303 (306 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP21809.1| unnamed protein product, partial [Coffea canephora] 56 9e-06 >emb|CDP21809.1| unnamed protein product, partial [Coffea canephora] Length = 1114 Score = 56.2 bits (134), Expect = 9e-06 Identities = 30/49 (61%), Positives = 36/49 (73%) Frame = -2 Query: 149 IKVLLGTVISLATNRTTLVYGFEEELERLSQFAALIQSFLIDAEDKMQS 3 +KVLLGTVIS+A +R +V E ELERLS AA+IQ FL DA+ KM S Sbjct: 10 VKVLLGTVISIAVDRIGMVREVEAELERLSNTAAMIQCFLADADGKMHS 58