BLASTX nr result
ID: Gardenia21_contig00046296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00046296 (278 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP17122.1| unnamed protein product [Coffea canephora] 74 4e-11 ref|XP_012833636.1| PREDICTED: gamma-tubulin complex component 4... 60 8e-07 emb|CAN68024.1| hypothetical protein VITISV_003625 [Vitis vinifera] 59 2e-06 ref|XP_002270318.1| PREDICTED: gamma-tubulin complex component 4... 58 2e-06 ref|XP_011077007.1| PREDICTED: gamma-tubulin complex component 4... 56 9e-06 ref|XP_011077004.1| PREDICTED: gamma-tubulin complex component 4... 56 9e-06 >emb|CDP17122.1| unnamed protein product [Coffea canephora] Length = 749 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 111 GYTGDLIVDEREQQDSLRINLSPDAPISEECSTFKLA 1 GYTGDLIVDEREQQD+LRINLSPDAPISEEC TFKLA Sbjct: 11 GYTGDLIVDEREQQDTLRINLSPDAPISEECFTFKLA 47 >ref|XP_012833636.1| PREDICTED: gamma-tubulin complex component 4 homolog [Erythranthe guttatus] gi|604348578|gb|EYU46733.1| hypothetical protein MIMGU_mgv1a001863mg [Erythranthe guttata] gi|604348579|gb|EYU46734.1| hypothetical protein MIMGU_mgv1a001863mg [Erythranthe guttata] Length = 748 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -3 Query: 111 GYTGDLIVDEREQQDSLRINLSPDAPISEECSTFKLA 1 GYTGDLI+D+RE Q+SLR+NLSPDAP+S+E TFKLA Sbjct: 11 GYTGDLIIDDREYQESLRVNLSPDAPLSDE-PTFKLA 46 >emb|CAN68024.1| hypothetical protein VITISV_003625 [Vitis vinifera] Length = 1529 Score = 58.5 bits (140), Expect = 2e-06 Identities = 32/50 (64%), Positives = 36/50 (72%) Frame = -3 Query: 150 SQIMXXXXXXXXLGYTGDLIVDEREQQDSLRINLSPDAPISEECSTFKLA 1 S+ M LGYTGDLI+DEREQ SL INLSPDAP+SE+ TFKLA Sbjct: 837 SEAMLHELLLALLGYTGDLIIDEREQHKSLGINLSPDAPVSED-RTFKLA 885 >ref|XP_002270318.1| PREDICTED: gamma-tubulin complex component 4 [Vitis vinifera] gi|297743902|emb|CBI36872.3| unnamed protein product [Vitis vinifera] Length = 743 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -3 Query: 111 GYTGDLIVDEREQQDSLRINLSPDAPISEECSTFKLA 1 GYTGDLI+DEREQ SL INLSPDAP+SE+ TFKLA Sbjct: 11 GYTGDLIIDEREQHKSLGINLSPDAPVSED-RTFKLA 46 >ref|XP_011077007.1| PREDICTED: gamma-tubulin complex component 4 isoform X2 [Sesamum indicum] Length = 651 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -3 Query: 111 GYTGDLIVDEREQQDSLRINLSPDAPISEECSTFKLA 1 GYTGDLI+DERE Q++LR+NLSP AP+++E TFKLA Sbjct: 11 GYTGDLIIDEREHQETLRVNLSPGAPLADE-PTFKLA 46 >ref|XP_011077004.1| PREDICTED: gamma-tubulin complex component 4 isoform X1 [Sesamum indicum] gi|747061099|ref|XP_011077005.1| PREDICTED: gamma-tubulin complex component 4 isoform X1 [Sesamum indicum] Length = 747 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -3 Query: 111 GYTGDLIVDEREQQDSLRINLSPDAPISEECSTFKLA 1 GYTGDLI+DERE Q++LR+NLSP AP+++E TFKLA Sbjct: 11 GYTGDLIIDEREHQETLRVNLSPGAPLADE-PTFKLA 46