BLASTX nr result
ID: Gardenia21_contig00046220
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00046220 (214 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP08926.1| unnamed protein product [Coffea canephora] 96 1e-17 >emb|CDP08926.1| unnamed protein product [Coffea canephora] Length = 417 Score = 95.9 bits (237), Expect = 1e-17 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = -2 Query: 174 CDSMKNMIFELSKTVKSGRDTCRLEAKLEALIEGLTSAKQLGIRKLRFFCKSHNLYDY 1 CDSMK+MIFE SK +KS DTCRLEA+LEALIEGLT AKQLGIR+LRFFCKS LY+Y Sbjct: 64 CDSMKHMIFESSKAMKSRGDTCRLEARLEALIEGLTGAKQLGIRRLRFFCKSRKLYNY 121