BLASTX nr result
ID: Gardenia21_contig00046196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00046196 (313 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJX95432.1| EH domain binding protein epsin 2 [Zymoseptoria b... 124 2e-26 ref|XP_003853784.1| hypothetical protein MYCGRDRAFT_69716 [Zymos... 124 2e-26 gb|EMF10350.1| ENTH-domain-containing protein [Sphaerulina musiv... 121 2e-25 gb|EME45671.1| hypothetical protein DOTSEDRAFT_150886 [Dothistro... 120 3e-25 ref|XP_007925594.1| hypothetical protein MYCFIDRAFT_187830 [Pseu... 118 2e-24 ref|XP_007674866.1| hypothetical protein BAUCODRAFT_146631 [Baud... 107 3e-21 gb|EYE91067.1| ENTH-domain-containing protein [Aspergillus ruber... 107 5e-21 ref|XP_007787687.1| hypothetical protein EPUS_08531 [Endocarpon ... 105 1e-20 dbj|GAA87969.1| EH domain binding protein epsin 2 [Aspergillus k... 105 1e-20 ref|XP_001390996.1| EH domain binding protein epsin 2 [Aspergill... 104 2e-20 emb|CEO59905.1| Putative EH domain binding protein epsin 2 [Peni... 104 3e-20 gb|KKK13738.1| EH domain binding protein [Aspergillus ochraceoro... 103 4e-20 ref|XP_013342855.1| hypothetical protein AUEXF2481DRAFT_30515 [A... 103 4e-20 gb|KEQ80778.1| ENTH-domain-containing protein [Aureobasidium pul... 103 4e-20 ref|XP_013427881.1| epsin-1 [Aureobasidium namibiae CBS 147.97] ... 103 4e-20 gb|KEQ63974.1| ENTH-domain-containing protein [Aureobasidium mel... 103 4e-20 ref|XP_001268311.1| EH domain binding protein epsin 2 [Aspergill... 103 7e-20 ref|XP_013269288.1| hypothetical protein Z518_08091 [Rhinocladie... 102 1e-19 dbj|GAQ02911.1| epsin-1 [Aspergillus lentulus] 102 1e-19 gb|KNG82074.1| EH domain binding protein epsin 2 [Aspergillus no... 102 1e-19 >gb|KJX95432.1| EH domain binding protein epsin 2 [Zymoseptoria brevis] Length = 553 Score = 124 bits (312), Expect = 2e-26 Identities = 59/63 (93%), Positives = 60/63 (95%) Frame = -1 Query: 199 DPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNPF 20 DPYQAKLN LLSSGEGQDTFGN GDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTG NPF Sbjct: 446 DPYQAKLNQLLSSGEGQDTFGNTGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGTNPF 505 Query: 19 FNQ 11 F+Q Sbjct: 506 FSQ 508 >ref|XP_003853784.1| hypothetical protein MYCGRDRAFT_69716 [Zymoseptoria tritici IPO323] gi|339473667|gb|EGP88760.1| hypothetical protein MYCGRDRAFT_69716 [Zymoseptoria tritici IPO323] Length = 553 Score = 124 bits (312), Expect = 2e-26 Identities = 59/63 (93%), Positives = 60/63 (95%) Frame = -1 Query: 199 DPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNPF 20 DPYQAKLN LLSSGEGQDTFGN GDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTG NPF Sbjct: 446 DPYQAKLNQLLSSGEGQDTFGNTGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGTNPF 505 Query: 19 FNQ 11 F+Q Sbjct: 506 FSQ 508 >gb|EMF10350.1| ENTH-domain-containing protein [Sphaerulina musiva SO2202] Length = 554 Score = 121 bits (304), Expect = 2e-25 Identities = 56/63 (88%), Positives = 61/63 (96%) Frame = -1 Query: 199 DPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNPF 20 DPYQAKLN+LL+SGEGQDTFGNVGDMRIPAQHTAPGTYVNSAG GSMGRLEA++TG NPF Sbjct: 445 DPYQAKLNSLLASGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGAGSMGRLEAAKTGTNPF 504 Query: 19 FNQ 11 F+Q Sbjct: 505 FSQ 507 >gb|EME45671.1| hypothetical protein DOTSEDRAFT_150886 [Dothistroma septosporum NZE10] Length = 548 Score = 120 bits (302), Expect = 3e-25 Identities = 55/66 (83%), Positives = 63/66 (95%) Frame = -1 Query: 199 DPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNPF 20 DPYQAKLNALL+SGEGQDTFGNVGD+RIP+QHTAPGT+VNSAG GSMGRLEA++TGNNPF Sbjct: 449 DPYQAKLNALLASGEGQDTFGNVGDLRIPSQHTAPGTFVNSAGAGSMGRLEAAKTGNNPF 508 Query: 19 FNQHTQ 2 ++Q Q Sbjct: 509 YSQPQQ 514 >ref|XP_007925594.1| hypothetical protein MYCFIDRAFT_187830 [Pseudocercospora fijiensis CIRAD86] gi|452985355|gb|EME85112.1| hypothetical protein MYCFIDRAFT_187830 [Pseudocercospora fijiensis CIRAD86] Length = 547 Score = 118 bits (296), Expect = 2e-24 Identities = 53/66 (80%), Positives = 63/66 (95%) Frame = -1 Query: 199 DPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNPF 20 DPYQAKLN+LL++G+GQDTFGNVGD+RIP+QHTAPGT+VNSAG GSMGRLEA++TGNNPF Sbjct: 446 DPYQAKLNSLLATGDGQDTFGNVGDLRIPSQHTAPGTFVNSAGAGSMGRLEAAKTGNNPF 505 Query: 19 FNQHTQ 2 F+Q Q Sbjct: 506 FSQAPQ 511 >ref|XP_007674866.1| hypothetical protein BAUCODRAFT_146631 [Baudoinia panamericana UAMH 10762] gi|449302034|gb|EMC98043.1| hypothetical protein BAUCODRAFT_146631 [Baudoinia panamericana UAMH 10762] Length = 583 Score = 107 bits (267), Expect = 3e-21 Identities = 49/65 (75%), Positives = 56/65 (86%) Frame = -1 Query: 199 DPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNPF 20 DPYQA LNALL+SG GQDTFGN G+MR+PA HTA T+VNSAG GSMGRLEA+RTGNNPF Sbjct: 459 DPYQAHLNALLASGAGQDTFGNTGEMRVPAHHTAGATFVNSAGQGSMGRLEAARTGNNPF 518 Query: 19 FNQHT 5 + Q + Sbjct: 519 YTQQS 523 >gb|EYE91067.1| ENTH-domain-containing protein [Aspergillus ruber CBS 135680] Length = 563 Score = 107 bits (266), Expect = 5e-21 Identities = 50/66 (75%), Positives = 59/66 (89%) Frame = -1 Query: 199 DPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNPF 20 +P+ A+LNALLSSGEGQDTFGNVGD+RIPAQHTAPGT++NSAG G M RL+A++TGNNPF Sbjct: 466 NPHHARLNALLSSGEGQDTFGNVGDLRIPAQHTAPGTFINSAGQG-MSRLQAAQTGNNPF 524 Query: 19 FNQHTQ 2 F Q Q Sbjct: 525 FGQQQQ 530 >ref|XP_007787687.1| hypothetical protein EPUS_08531 [Endocarpon pusillum Z07020] gi|539439395|gb|ERF74990.1| hypothetical protein EPUS_08531 [Endocarpon pusillum Z07020] Length = 1833 Score = 105 bits (263), Expect = 1e-20 Identities = 50/64 (78%), Positives = 58/64 (90%) Frame = -1 Query: 202 VDPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNP 23 +DP +A+LNALL+SGEGQDTFGNVGD+RIPAQHTAPGT+VNSAG G M RL A++TGNNP Sbjct: 1717 MDPQRARLNALLASGEGQDTFGNVGDLRIPAQHTAPGTFVNSAG-GGMDRLRAAQTGNNP 1775 Query: 22 FFNQ 11 FF Q Sbjct: 1776 FFQQ 1779 >dbj|GAA87969.1| EH domain binding protein epsin 2 [Aspergillus kawachii IFO 4308] Length = 577 Score = 105 bits (263), Expect = 1e-20 Identities = 50/66 (75%), Positives = 58/66 (87%) Frame = -1 Query: 199 DPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNPF 20 DP++A+LNALL+SGEGQDTFGN GD+RIPAQHTAPGT+VNSAG G + RL A+RTGNNPF Sbjct: 476 DPHRAQLNALLASGEGQDTFGNTGDLRIPAQHTAPGTFVNSAGQG-LDRLRATRTGNNPF 534 Query: 19 FNQHTQ 2 F Q Q Sbjct: 535 FGQQPQ 540 >ref|XP_001390996.1| EH domain binding protein epsin 2 [Aspergillus niger CBS 513.88] gi|134075457|emb|CAK48018.1| unnamed protein product [Aspergillus niger] gi|350630159|gb|EHA18532.1| hypothetical protein ASPNIDRAFT_207670 [Aspergillus niger ATCC 1015] Length = 575 Score = 104 bits (260), Expect = 2e-20 Identities = 49/66 (74%), Positives = 58/66 (87%) Frame = -1 Query: 199 DPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNPF 20 DP++A+LNALL+SGEGQDTFGN GD+RIPAQHTAPGT+VNSAG G + RL A+RTGNNPF Sbjct: 474 DPHRAQLNALLASGEGQDTFGNTGDLRIPAQHTAPGTFVNSAGQG-LDRLRATRTGNNPF 532 Query: 19 FNQHTQ 2 + Q Q Sbjct: 533 YGQQPQ 538 >emb|CEO59905.1| Putative EH domain binding protein epsin 2 [Penicillium brasilianum] Length = 573 Score = 104 bits (259), Expect = 3e-20 Identities = 49/63 (77%), Positives = 57/63 (90%) Frame = -1 Query: 199 DPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNPF 20 DP+ A+LNALL+SGEGQDTFGNVGD+RIPAQHTAPGT+VNSAG G + RL A++TGNNPF Sbjct: 475 DPHHARLNALLASGEGQDTFGNVGDLRIPAQHTAPGTFVNSAGQG-LDRLHAAQTGNNPF 533 Query: 19 FNQ 11 F Q Sbjct: 534 FGQ 536 >gb|KKK13738.1| EH domain binding protein [Aspergillus ochraceoroseus] gi|816338168|gb|KKK17144.1| EH domain binding protein [Aspergillus rambellii] Length = 543 Score = 103 bits (258), Expect = 4e-20 Identities = 49/67 (73%), Positives = 58/67 (86%) Frame = -1 Query: 202 VDPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNP 23 +DP+ A+LNALL+SGEGQDTFGN GD+RIPAQHTAPGT+VNSAG G + RL A+RTGNNP Sbjct: 443 MDPHTARLNALLASGEGQDTFGNTGDLRIPAQHTAPGTFVNSAGQG-LDRLRATRTGNNP 501 Query: 22 FFNQHTQ 2 F+ Q Q Sbjct: 502 FYGQPQQ 508 >ref|XP_013342855.1| hypothetical protein AUEXF2481DRAFT_30515 [Aureobasidium subglaciale EXF-2481] gi|662537241|gb|KEQ94551.1| hypothetical protein AUEXF2481DRAFT_30515 [Aureobasidium subglaciale EXF-2481] Length = 561 Score = 103 bits (258), Expect = 4e-20 Identities = 50/61 (81%), Positives = 58/61 (95%) Frame = -1 Query: 202 VDPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNP 23 +DP++A+LNALLSSGEGQDTFGNVG+MRIPAQHTAPGT+VNSAG G + +LEASRTGNNP Sbjct: 457 MDPHRAQLNALLSSGEGQDTFGNVGNMRIPAQHTAPGTFVNSAGQG-LTKLEASRTGNNP 515 Query: 22 F 20 F Sbjct: 516 F 516 >gb|KEQ80778.1| ENTH-domain-containing protein [Aureobasidium pullulans EXF-150] Length = 561 Score = 103 bits (258), Expect = 4e-20 Identities = 50/61 (81%), Positives = 58/61 (95%) Frame = -1 Query: 202 VDPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNP 23 +DP++A+LNALLSSGEGQDTFGNVG+MRIPAQHTAPGT+VNSAG G + +LEASRTGNNP Sbjct: 457 MDPHRAQLNALLSSGEGQDTFGNVGNMRIPAQHTAPGTFVNSAGQG-LTKLEASRTGNNP 515 Query: 22 F 20 F Sbjct: 516 F 516 >ref|XP_013427881.1| epsin-1 [Aureobasidium namibiae CBS 147.97] gi|662516124|gb|KEQ73688.1| epsin-1 [Aureobasidium namibiae CBS 147.97] Length = 561 Score = 103 bits (258), Expect = 4e-20 Identities = 50/61 (81%), Positives = 58/61 (95%) Frame = -1 Query: 202 VDPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNP 23 +DP++A+LNALLSSGEGQDTFGNVG+MRIPAQHTAPGT+VNSAG G + +LEASRTGNNP Sbjct: 457 MDPHRAQLNALLSSGEGQDTFGNVGNMRIPAQHTAPGTFVNSAGQG-LTKLEASRTGNNP 515 Query: 22 F 20 F Sbjct: 516 F 516 >gb|KEQ63974.1| ENTH-domain-containing protein [Aureobasidium melanogenum CBS 110374] Length = 560 Score = 103 bits (258), Expect = 4e-20 Identities = 50/61 (81%), Positives = 58/61 (95%) Frame = -1 Query: 202 VDPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNP 23 +DP++A+LNALLSSGEGQDTFGNVG+MRIPAQHTAPGT+VNSAG G + +LEASRTGNNP Sbjct: 456 MDPHRAQLNALLSSGEGQDTFGNVGNMRIPAQHTAPGTFVNSAGQG-LTKLEASRTGNNP 514 Query: 22 F 20 F Sbjct: 515 F 515 >ref|XP_001268311.1| EH domain binding protein epsin 2 [Aspergillus clavatus NRRL 1] gi|119396453|gb|EAW06885.1| EH domain binding protein epsin 2 [Aspergillus clavatus NRRL 1] Length = 560 Score = 103 bits (256), Expect = 7e-20 Identities = 48/63 (76%), Positives = 57/63 (90%) Frame = -1 Query: 199 DPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNPF 20 +P+ A+LNALLS+GEGQDTFGNVGD+RIPAQHTAPGT+VNSAG G + RL A+ TGNNPF Sbjct: 462 NPHHARLNALLSTGEGQDTFGNVGDLRIPAQHTAPGTFVNSAGQG-LDRLRATHTGNNPF 520 Query: 19 FNQ 11 +NQ Sbjct: 521 YNQ 523 >ref|XP_013269288.1| hypothetical protein Z518_08091 [Rhinocladiella mackenziei CBS 650.93] gi|759325822|gb|KIX02152.1| hypothetical protein Z518_08091 [Rhinocladiella mackenziei CBS 650.93] Length = 568 Score = 102 bits (254), Expect = 1e-19 Identities = 49/64 (76%), Positives = 57/64 (89%) Frame = -1 Query: 202 VDPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNP 23 V+P AKLNALL+SGEGQDTFGN GD+RIPAQHTAPGT+VNSAG G + RL A++TGNNP Sbjct: 462 VNPQHAKLNALLASGEGQDTFGNTGDLRIPAQHTAPGTFVNSAGQG-LERLHAAQTGNNP 520 Query: 22 FFNQ 11 FF+Q Sbjct: 521 FFSQ 524 >dbj|GAQ02911.1| epsin-1 [Aspergillus lentulus] Length = 562 Score = 102 bits (253), Expect = 1e-19 Identities = 47/63 (74%), Positives = 57/63 (90%) Frame = -1 Query: 199 DPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNPF 20 +P+ A+LNALL++GEGQDTFGNVGD+RIPAQHTAPGT+VNSAG G + RL A+ TGNNPF Sbjct: 464 NPHHARLNALLATGEGQDTFGNVGDLRIPAQHTAPGTFVNSAGQG-LDRLRATHTGNNPF 522 Query: 19 FNQ 11 +NQ Sbjct: 523 YNQ 525 >gb|KNG82074.1| EH domain binding protein epsin 2 [Aspergillus nomius NRRL 13137] Length = 576 Score = 102 bits (253), Expect = 1e-19 Identities = 47/63 (74%), Positives = 57/63 (90%) Frame = -1 Query: 199 DPYQAKLNALLSSGEGQDTFGNVGDMRIPAQHTAPGTYVNSAGLGSMGRLEASRTGNNPF 20 DP+ A+LNALL+SG+GQDTFGNVGD+RIPAQHTAPGT+VNSAG G + RL +++TGNNPF Sbjct: 471 DPHHARLNALLASGDGQDTFGNVGDLRIPAQHTAPGTFVNSAGQG-LDRLRSNQTGNNPF 529 Query: 19 FNQ 11 F Q Sbjct: 530 FGQ 532