BLASTX nr result
ID: Gardenia21_contig00046094
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00046094 (321 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP12765.1| unnamed protein product [Coffea canephora] 68 5e-15 gb|KNA12349.1| hypothetical protein SOVF_126660 [Spinacia oleracea] 57 5e-06 >emb|CDP12765.1| unnamed protein product [Coffea canephora] Length = 387 Score = 68.2 bits (165), Expect(2) = 5e-15 Identities = 39/74 (52%), Positives = 43/74 (58%), Gaps = 3/74 (4%) Frame = -1 Query: 321 DDYKIVW---PYGGTRIRGSENLVIVLSLRNGTWRTLENRPYAPTIHSGVFLNGSVRWLA 151 DDYKIV + + G V V S R GTWR + PY P+ HSGVFLNGS WLA Sbjct: 177 DDYKIVMLSHDWLADKTEGYPAFVDVFSWRTGTWRRIGCFPYVPSSHSGVFLNGSTHWLA 236 Query: 150 QSKVDESQVIAALD 109 SKVD VI ALD Sbjct: 237 LSKVDGLCVIIALD 250 Score = 39.3 bits (90), Expect(2) = 5e-15 Identities = 18/33 (54%), Positives = 23/33 (69%) Frame = -3 Query: 100 EEFKQMPWPSTSCSTRNRGSLASSKQLVVLGGC 2 E+FKQ+PWP T + R R S++LVVLGGC Sbjct: 254 EQFKQLPWPETDNTPRKR-----SRKLVVLGGC 281 >gb|KNA12349.1| hypothetical protein SOVF_126660 [Spinacia oleracea] Length = 396 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 3/58 (5%) Frame = -1 Query: 273 SENLVIVLSLRNGTWRTLENRPYAPTI---HSGVFLNGSVRWLAQSKVDESQVIAALD 109 +E V V S+ NGTW+ +++ PY TI +G F+NGS+ WLA+ VD+S VIAA D Sbjct: 188 NEMFVDVYSVGNGTWKRVDSSPYDHTISDFEAGAFVNGSIHWLARRTVDDSYVIAAFD 245