BLASTX nr result
ID: Gardenia21_contig00046062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00046062 (388 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP01860.1| unnamed protein product [Coffea canephora] 65 3e-08 >emb|CDP01860.1| unnamed protein product [Coffea canephora] Length = 580 Score = 64.7 bits (156), Expect = 3e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 388 LEDLTGIVQKLKVGAKWQEFTDSCQLRFSEVTD 290 LEDLTGIVQK+KVGAKWQEFTDSCQLR SEV D Sbjct: 548 LEDLTGIVQKMKVGAKWQEFTDSCQLRSSEVND 580