BLASTX nr result
ID: Gardenia21_contig00045835
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Gardenia21_contig00045835 (342 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF11137.1| hypothetical protein SEPMUDRAFT_134346 [Sphaeruli... 68 2e-09 >gb|EMF11137.1| hypothetical protein SEPMUDRAFT_134346 [Sphaerulina musiva SO2202] Length = 143 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = -2 Query: 284 MPRDGSGHSHNAVEAGEHIIHGQPTGNEQPTGFGVDRSSK 165 MPRDGSGHSHNA EAG +I HG P GNEQPT GVDRS K Sbjct: 1 MPRDGSGHSHNAEEAGHNIQHGAPQGNEQPTSSGVDRSGK 40